PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400005770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARR-B
Protein Properties Length: 774aa    MW: 85312.5 Da    PI: 6.7268
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400005770genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like75.47.9e-24211259251
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                           +r++W+ eLH++Fv av qL G+ekA+Pk+il+lm+v+gLt+e+v+SHLQ
  PGSC0003DMP400005770 211 ARVVWSIELHRKFVAAVGQL-GIEKAVPKRILDLMNVDGLTRENVASHLQ 259
                           79******************.***************************** PP

2Response_reg80.75e-27281361109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl vdD+p+ ++ll  +l+k +y +v+++++++ al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+++ +++ 
  PGSC0003DMP400005770  28 VLAVDDDPICLKLLDGLLRKCQY-QVTTTSQARMALKMLRENRdrFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANSDTKLVR 114
                           799********************.***************999889*******************87754.558**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + ++ Ga d+l+Kp+ +eel++
  PGSC0003DMP400005770 115 KGIDHGACDYLVKPVRIEELRN 136
                           ********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521726.55E-3625152IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.5E-4325160No hitNo description
SMARTSM004488.0E-3326138IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.89727142IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.9E-2428137IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.92E-2929142No hitNo description
SuperFamilySSF466894.48E-14207260IPR009057Homeodomain-like
PROSITE profilePS512949.925207266IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-23207259IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-20211260IPR006447Myb domain, plants
SuperFamilySSF525403.74E-15285366IPR027417P-loop containing nucleoside triphosphate hydrolase
Gene3DG3DSA:3.40.50.3002.7E-17289377IPR027417P-loop containing nucleoside triphosphate hydrolase
CDDcd000091.05E-8308366No hitNo description
PfamPF000048.2E-11310365IPR003959ATPase, AAA-type, core
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 774 aa     Download sequence    Send to blast
MTVEEIRGNM GGGERGNNYD NFPIGMRVLA VDDDPICLKL LDGLLRKCQY QVTTTSQARM  60
ALKMLRENRD RFDLVISDVH MPDMDGFKLL ELVGLEMDLP VIMLSANSDT KLVRKGIDHG  120
ACDYLVKPVR IEELRNIWQH VIRKKKVEPK SQSKSNDQDK SYQVSGESGR GQSPTGNVDQ  180
NGKCNKKRKD EEDENDENGN DDEDPTTQKR ARVVWSIELH RKFVAAVGQL GIEKAVPKRI  240
LDLMNVDGLT RENVASHLQA LPVGEVGETK SMYKEIVLGG DVWDLLDELM IYMGNPMQYY  300
EKDVKFVRGV LLSGPPGTGK TLFARTLAKE SGMPFVFASG AEFTDSEKSG AARINEMFSV  360
ARRNKYRLYL KRINSVQTQQ ANMVAALGGR DYVRMGSLDG LGDFRTLGGS GRYTHAALSS  420
YSSGGMLGRL NSAAGLSVRN LAASQLLQPS HGQNLSNSVN AFTKLNPNIP PASQNASLFQ  480
GIPASLELDQ LQQSKSSAHI PLDESRLLTA EVLGCSNNSL SNVPNIPMLL QGNPQQPLTG  540
GGFGNQHSQN MTPFSSDSFN TGVNGSSNFL EHGRCNENWQ NSIQLSKFQS NSFPLTESFI  600
NSHLPQNSVR EATTHLQNSP LDFTSTTSVS PPFEDSRGEI QYRQSMAGAV QSMNQTPSQA  660
WADNKQHYSH NSNNTFGNNL RSQVPNDGNM ASLSHSMNQS NENFGRRMDM SLIGRSSGGS  720
STLVQQTEHE KLTLDSRTRS NEDYLLEPTK QQVGFSPQGY DSLDDLMTAM KRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-21206264159ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400005770
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754460.0HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343681.10.0PREDICTED: two-component response regulator ORR24-like
SwissprotA2X1N21e-105ORR24_ORYSI; Two-component response regulator ORR24
SwissprotB8AEH11e-105ORR23_ORYSI; Two-component response regulator ORR23
SwissprotQ6H8051e-105ORR24_ORYSJ; Two-component response regulator ORR24
SwissprotQ6K8X61e-105ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLM0ZUD00.0M0ZUD0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000082900.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22582458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-93response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]