PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400005111
Common NameLOC102591523
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 284aa    MW: 32720.3 Da    PI: 9.1356
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400005111genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81e-53101351128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrFhPtdeel+ +yL++++++++++  ++i+evdiyk++Pw+Lp+k++ +ekewyfF++rd+ky++g r+nra+ sgyWkatg+d
  PGSC0003DMP400005111  10 LPPGFRFHPTDEELIIYYLRNQATSRPCPS-SIIPEVDIYKFDPWELPEKAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTD 97 
                           79**************************99.89***************99999************************************ PP

                   NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           k+++s +++ vg+kk Lvfykg+ pkg ktdW+mheyrl
  PGSC0003DMP400005111  98 KAIYS-GTKYVGIKKALVFYKGKPPKGIKTDWIMHEYRL 135
                           *****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-657163IPR003441NAC domain
PROSITE profilePS5100561.25910163IPR003441NAC domain
PfamPF023651.8E-2611135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MIGKNNSNHL PPGFRFHPTD EELIIYYLRN QATSRPCPSS IIPEVDIYKF DPWELPEKAE  60
FGEKEWYFFT PRDRKYPNGV RPNRAAVSGY WKATGTDKAI YSGTKYVGIK KALVFYKGKP  120
PKGIKTDWIM HEYRLSESRT QPITRPNGSM RLDDWVLCRI YKKKNLGRAI EMMKVEEDTQ  180
QPQIMSVINP SEVVASNGQQ TMKLPRTCSL SHLLEMDYFG SISQLFDDNN SYNTISQNNT  240
LMTNGYVVPH QAMEIFQLGE VSQNNSNSFL KQPIFMNPSF QFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-73916514170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400005111
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754431e-153HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006344264.10.0PREDICTED: NAC transcription factor 29-like
SwissprotK4BNG70.0NAP2_SOLLC; NAC domain-containing protein 2
TrEMBLM0ZSU10.0M0ZSU1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000073410.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-113NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  3. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]