PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400002820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 468aa    MW: 52643.4 Da    PI: 6.5113
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400002820genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS209.81.5e-64974652374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl....fs 85 
                            elL + A+ v+++ + +a++lL+  ++ as +g+p+q+++ yf+ AL++r+ r +++ l+   +  e  + +++e +    l    f 
  PGSC0003DMP400002820  97 AELLQASAQLVATRTFDRARKLLSLCNQSASATGTPVQKIVYYFADALQHRIDReMGKMLFTGEEDIEVYSIEMEEFIID--LepaeFA 183
                           5789999***********************************************33333333222222222223333332..2335544 PP

                  GRAS  86 e..vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAee 171
                           +  +  + + + +t  qaIl+ + +++rvH iD+ i+ G +W +++q  a+R+e p  +l+i +vg+    sk+++e +g+rL+ fA+e
  PGSC0003DMP400002820 184 KrpLYAYRQATKFTGIQAILDCTITAKRVHLIDLAIKSGSHWTTFMQVVADRDECPLkHLKISAVGR----SKKMIEDVGRRLSAFAAE 268
                           322455788999*****************************************65544*********....9***************98 PP

                  GRAS 172 ..lgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfl 258
                             ++v+f f++ v+++l++l++++++v+ +E++a  +   l ++l+ + +les    ++++++sl P ++vv+e  a++n ++F + f 
  PGSC0003DMP400002820 269 tlVNVSFCFKT-VVSDLKNLKTDSFDVEADEVVAFYSDTILWTMLAWPNELES----MMEVIRSLDPCIMVVIEAVANTNLPKFIDSFD 352
                           33477888888.799******************************88888888....******************************** PP

                  GRAS 259 ealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                           e+l+++sa+ d++++     ++  +    +++++ i+n+++  g+e + r   l+ Wr+ ++++ + + +ls++  +qa+ll +  k++
  PGSC0003DMP400002820 353 ESLNHFSAVADCFDVY----HKGVAIAGGFYIQKIIRNMITYHGEETVPRYGDLKVWRDLFSRFHMVETELSHSSLCQASLLFELPKFR 437
                           ***************9....889999999************************************************************ PP

                  GRAS 348 gy.rveeesgslvlgWkdrpLvsvSaWr 374
                           g+ + e + ++lv+ Wk+ p++s+SaW+
  PGSC0003DMP400002820 438 GFcTFEMDGKWLVISWKGTPIISASAWK 465
                           *736778899999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098530.44470444IPR005202Transcription factor GRAS
PfamPF035145.1E-6297465IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MDSSSSHARN KKKANQCSDH AEGRQGSLRQ GLNESSFQLS RGTSGSLVLS APTIMKIAKQ  60
RLLNHISQKF DPYSIIFNPL TANSGLSPEL LQDLDLAELL QASAQLVATR TFDRARKLLS  120
LCNQSASATG TPVQKIVYYF ADALQHRIDR EMGKMLFTGE EDIEVYSIEM EEFIIDLEPA  180
EFAKRPLYAY RQATKFTGIQ AILDCTITAK RVHLIDLAIK SGSHWTTFMQ VVADRDECPL  240
KHLKISAVGR SKKMIEDVGR RLSAFAAETL VNVSFCFKTV VSDLKNLKTD SFDVEADEVV  300
AFYSDTILWT MLAWPNELES MMEVIRSLDP CIMVVIEAVA NTNLPKFIDS FDESLNHFSA  360
VADCFDVYHK GVAIAGGFYI QKIIRNMITY HGEETVPRYG DLKVWRDLFS RFHMVETELS  420
HSSLCQASLL FELPKFRGFC TFEMDGKWLV ISWKGTPIIS ASAWKFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-2411946526375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015160788.10.0PREDICTED: scarecrow-like protein 28
TrEMBLM0ZMM40.0M0ZMM4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000039540.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.15e-38RGA-like 1
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]