PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400002396
Common NameLOC102578811
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 324aa    MW: 36723.3 Da    PI: 6.7075
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400002396genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.78.7e-57161411128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrFhPtdeel+++yL++kv ++++ +  +i evd++kvePwdLp k+k +ekewyfF+ rdkky+tg+r+nrat++gyWkatgkd
  PGSC0003DMP400002396  16 LPPGFRFHPTDEELITHYLAPKVLDSSFCA-IAIGEVDLNKVEPWDLPWKAKMGEKEWYFFCMRDKKYPTGQRTNRATEAGYWKATGKD 103
                           79*************************888.78***************888999*********************************** PP

                   NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           ke+++ +++ vg+kktLvfykgrap+gekt+Wvmheyrl
  PGSC0003DMP400002396 104 KEIFK-SKTFVGMKKTLVFYKGRAPRGEKTNWVMHEYRL 141
                           *****.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-6313166IPR003441NAC domain
PROSITE profilePS5100558.50416166IPR003441NAC domain
PfamPF023651.5E-3017141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MESVCGFGGK EEEMELPPGF RFHPTDEELI THYLAPKVLD SSFCAIAIGE VDLNKVEPWD  60
LPWKAKMGEK EWYFFCMRDK KYPTGQRTNR ATEAGYWKAT GKDKEIFKSK TFVGMKKTLV  120
FYKGRAPRGE KTNWVMHEYR LDGKYSIHNL PKTAKNECVI CRIFKKNSGG KKIAISNLTR  180
SGSLTDNSRS SNLPPLMDMS PYNNNTQITT TARSSGETCN SHVTCFSDSV EDQKPQTYDH  240
YHAPLSSSPV SVDFPSNVPN ESMAYMENFQ YGDSGLMQDN SIMRLLIDNN YGSESKQSLR  300
GYEDHDFNIT STGPVDIDCL WNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-531317214171NO APICAL MERISTEM PROTEIN
1ut4_B3e-531317214171NO APICAL MERISTEM PROTEIN
1ut7_A3e-531317214171NO APICAL MERISTEM PROTEIN
1ut7_B3e-531317214171NO APICAL MERISTEM PROTEIN
3swm_A4e-531317217174NAC domain-containing protein 19
3swm_B4e-531317217174NAC domain-containing protein 19
3swm_C4e-531317217174NAC domain-containing protein 19
3swm_D4e-531317217174NAC domain-containing protein 19
3swp_A4e-531317217174NAC domain-containing protein 19
3swp_B4e-531317217174NAC domain-containing protein 19
3swp_C4e-531317217174NAC domain-containing protein 19
3swp_D4e-531317217174NAC domain-containing protein 19
4dul_A3e-531317214171NAC domain-containing protein 19
4dul_B3e-531317214171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400002396
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT7409940.0KT740994.1 Solanum lycopersicum NAC2-domain containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006338435.10.0PREDICTED: NAC domain-containing protein 92
SwissprotQ9FLJ21e-125NC100_ARATH; NAC domain-containing protein 100
TrEMBLM0ZLJ30.0M0ZLJ3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000033800.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-127NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]