PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400002374
Common NameLOC102585859
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 397aa    MW: 44757.9 Da    PI: 5.8249
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400002374genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.32.5e-52141411128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           + pGfrFhPtdeelv +yLk+k+++++l++ e ik+vdiyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d
  PGSC0003DMP400002374  14 MLPGFRFHPTDEELVGFYLKRKIQQRSLPI-ELIKQVDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTD 101
                           579***************************.89***************9888999********************************** PP

                   NAM  90 kevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                           ++++s+ +++ +glkk+Lvfy+gra +g ktdW+mhe+rl
  PGSC0003DMP400002374 102 RPIYSSdSTKCIGLKKSLVFYRGRAARGIKTDWMMHEFRL 141
                           *****955666***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-5811173IPR003441NAC domain
PROSITE profilePS5100557.08214173IPR003441NAC domain
PfamPF023651.5E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MDDKSDVEKL DEVMLPGFRF HPTDEELVGF YLKRKIQQRS LPIELIKQVD IYKYDPWDLP  60
KLASTGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSDST KCIGLKKSLV  120
FYRGRAARGI KTDWMMHEFR LPTTNSESGP PKKFLDKNFP PNDSWAICRI FKKTSSMANR  180
ALSYTWVNPL SEVASPELFN QSANTHFISE NVSSITEAGS VLHLSNNSDL LQGVSNVPSY  240
KALNTMASRQ SYLSSPSTDI SYNFMFSSPE VSGQNSRCLL DANSMFFNTS PGLITDISKT  300
SESIDFDGPN QQLNSFSISS SQEMQRSISM EDGEEGLRSN QTSTNDNTEW ENMRSVGFPF  360
SLTASLADEW KPSLSWDSPP CPSEISTSFS TNKCYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-531617619168NO APICAL MERISTEM PROTEIN
1ut4_B6e-531617619168NO APICAL MERISTEM PROTEIN
1ut7_A6e-531617619168NO APICAL MERISTEM PROTEIN
1ut7_B6e-531617619168NO APICAL MERISTEM PROTEIN
3swm_A6e-531617622171NAC domain-containing protein 19
3swm_B6e-531617622171NAC domain-containing protein 19
3swm_C6e-531617622171NAC domain-containing protein 19
3swm_D6e-531617622171NAC domain-containing protein 19
3swp_A6e-531617622171NAC domain-containing protein 19
3swp_B6e-531617622171NAC domain-containing protein 19
3swp_C6e-531617622171NAC domain-containing protein 19
3swp_D6e-531617622171NAC domain-containing protein 19
4dul_A6e-531617619168NAC domain-containing protein 19
4dul_B6e-531617619168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00537DAPTransfer from AT5G39820Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400002374
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006338456.10.0PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9FIW51e-101NAC94_ARATH; Putative NAC domain-containing protein 94
SwissprotQ9ZVH01e-100FEZ_ARATH; Protein FEZ
TrEMBLM0ZLH20.0M0ZLH2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000033430.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22022262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.11e-103NAC domain containing protein 94
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]