PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400001684
Common NameLOC102605536
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 317aa    MW: 36762.9 Da    PI: 6.2384
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400001684genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.11.7e-5371351128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPt+eelv +yLk+k+++ k++l +vi+e+d+y++ePwd++   k+   e++ewyfFs++d+ky+tg+r+nrat +g+Wkat
  PGSC0003DMP400001684   7 VPPGFRFHPTEEELVGYYLKRKINSLKIDL-DVITEIDLYRMEPWDIQDrcKLGYeEQSEWYFFSHKDRKYPTGTRTNRATGAGFWKAT 94 
                           69****************************.9***************952433332566****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           g+dk+vls k++ +g++ktLvfy+grap+g+k+dW+mheyrl
  PGSC0003DMP400001684  95 GRDKAVLS-KEKIIGMRKTLVFYRGRAPNGRKSDWIMHEYRL 135
                           ********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-605156IPR003441NAC domain
PROSITE profilePS5100558.2167156IPR003441NAC domain
PfamPF023652.6E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEMESCVPPG FRFHPTEEEL VGYYLKRKIN SLKIDLDVIT EIDLYRMEPW DIQDRCKLGY  60
EEQSEWYFFS HKDRKYPTGT RTNRATGAGF WKATGRDKAV LSKEKIIGMR KTLVFYRGRA  120
PNGRKSDWIM HEYRLQTSQH GPPQEEGWVV CRAFKKPSPS NNNIAYNYYM RGTNTSYSTR  180
PPPSLSQIPS YNININPLNQ TSNFNHQFPF NHQVSSQNNI VYDNNQLVIH ELPQLDSPTI  240
STSLATNDHQ GQNSMNNNNN EDQFCDEWNI DDKLFAPQVI MNMEAPSSSS YSYPNFPLVD  300
DDQNHMSQLL QCYPDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A9e-50716220174NAC domain-containing protein 19
3swm_B9e-50716220174NAC domain-containing protein 19
3swm_C9e-50716220174NAC domain-containing protein 19
3swm_D9e-50716220174NAC domain-containing protein 19
3swp_A9e-50716220174NAC domain-containing protein 19
3swp_B9e-50716220174NAC domain-containing protein 19
3swp_C9e-50716220174NAC domain-containing protein 19
3swp_D9e-50716220174NAC domain-containing protein 19
3ulx_A8e-50215610168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20488898, PubMed:22037706, PubMed:21284754). Involved in xylem formation in roots and shoots, especially regulating protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:16103214, PubMed:18445131, PubMed:20488898, PubMed:21498679, PubMed:21284754). Can activate the expression of several genes including XCP1, MYB46, NAC010/SND3, MYB103, MYB58, MYB63, MYB83, KNAT7, ASL19 and ASL20 (PubMed:17890373, PubMed:19088331, PubMed:18952777, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:21284754). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:20488898, ECO:0000269|PubMed:20935069, ECO:0000269|PubMed:21284754, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22037706}.; FUNCTION: Required for the soilborne fungal pathogen Verticillium longisporum-induced transdifferentiation of chloroplast-containing bundle sheath cells to functional xylem elements leading to stunted growth, vein clearing, and leaf chloroses, as well as xylem hyperplasia within the vasculature of leaves, hypocotyls, and roots due to reinitiation of cambial activity and transdifferentiation of xylem parenchyma cells. This developmental reprogramming mediates also an increased drought stress tolerance. {ECO:0000269|PubMed:23023171}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400001684
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214, PubMed:22345435). Up-regulated in a feed-back loop by ASL20 (PubMed:19088331). Levels are monitored by proteasome-mediated degradation (PubMed:18445131). Repressed by WEE1 upon replication stress to prevent premature tracheary element differentiation (PubMed:21498679). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22345435, ECO:0000269|PubMed:23023171}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006351930.10.0PREDICTED: NAC domain-containing protein 30
SwissprotQ9C8W91e-111NAC30_ARATH; NAC domain-containing protein 30
TrEMBLM0ZJX90.0M0ZJX9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000023180.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-102vascular related NAC-domain protein 7
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Kakehi J, et al.
    Mutations in ribosomal proteins, RPL4 and RACK1, suppress the phenotype of a thermospermine-deficient mutant of Arabidopsis thaliana.
    PLoS ONE, 2015. 10(1): p. e0117309
    [PMID:25625317]
  4. Li Z, et al.
    A Transcriptional and Metabolic Framework for Secondary Wall Formation in Arabidopsis.
    Plant Physiol., 2016. 172(2): p. 1334-1351
    [PMID:27566165]
  5. de Lucas M, et al.
    Transcriptional Regulation of Arabidopsis Polycomb Repressive Complex 2 Coordinates Cell-Type Proliferation and Differentiation.
    Plant Cell, 2016. 28(10): p. 2616-2631
    [PMID:27650334]
  6. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]
  7. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]