PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400001114
Common NameLOC102593794
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 639aa    MW: 70807 Da    PI: 4.948
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400001114genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.26.6e-53271551128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           lp+G+rF+Ptdeelv++yL+ k++g + ++ +vi+evdi+k+ePwdLp  + v+++++ew+fF+++d+ky++g+r nrat++gyWkatg
  PGSC0003DMP400001114  27 LPVGYRFRPTDEELVNHYLRLKINGADSQV-SVIREVDICKLEPWDLPdlSVVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATG 114
                           799************************999.99**************96448888999******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           kd+++++kkg+++g+kktLv+y grap+g++t+Wv+heyr+
  PGSC0003DMP400001114 115 KDRNIVTKKGAKIGMKKTLVYYIGRAPEGKRTHWVIHEYRA 155
                           ***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5822178IPR003441NAC domain
PROSITE profilePS5100555.46227178IPR003441NAC domain
PfamPF023651.4E-2628154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002230Biological Processpositive regulation of defense response to virus by host
GO:0002237Biological Processresponse to molecule of bacterial origin
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 639 aa     Download sequence    Send to blast
MAVLPGENPI AVLPVDKQMG IPPLNTLPVG YRFRPTDEEL VNHYLRLKIN GADSQVSVIR  60
EVDICKLEPW DLPDLSVVES HDNEWFFFCP KDRKYQNGQR LNRATERGYW KATGKDRNIV  120
TKKGAKIGMK KTLVYYIGRA PEGKRTHWVI HEYRATEKSL DGSHPGQGAF VLCRLFRKND  180
LKQDEHVENS NLDAEQNASV DKSPAEDELS EAATPLMVIQ PLSDCDKSYA AKFSKGEMYG  240
KQIPIESHSN SCIADDTEDQ MLDITSIPPV QDLEKELGNF YDPSSQPDWK IFSPLHSQMQ  300
VELGSSYLQA PFNNDICGYQ KDVQFPYGTN ALEINDFLNS ILVNSDELSC EDSGQELASH  360
HIDTKNYSIT GPMIKDSGSC SESEAEVTQG QVDPGFFDPE VLWDNFDREA AVKREVNSLE  420
HTVLKARSPL GPSYDGNDYA VGNLGFFQNT YPGHYGYPAS IGGSQVPNFL KVEQSGVRNN  480
VVSTESGSGT GIKLRTRQMH NQPDDTQSRP QGTAHRRIRL GVKMQVGPVE CRMRSVSSQG  540
AEIHQAVAEG EKACDEHSST TSDNTTHKDL EGVVGETDEL STRVKDADDS PVQESLDVSL  600
KTATKLSSSS HVYMSKVLVV ASLLVVFIGV WGCFRLCV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-442618316170NO APICAL MERISTEM PROTEIN
1ut4_B3e-442618316170NO APICAL MERISTEM PROTEIN
1ut7_A3e-442618316170NO APICAL MERISTEM PROTEIN
1ut7_B3e-442618316170NO APICAL MERISTEM PROTEIN
3swm_A4e-442618319173NAC domain-containing protein 19
3swm_B4e-442618319173NAC domain-containing protein 19
3swm_C4e-442618319173NAC domain-containing protein 19
3swm_D4e-442618319173NAC domain-containing protein 19
3swp_A4e-442618319173NAC domain-containing protein 19
3swp_B4e-442618319173NAC domain-containing protein 19
3swp_C4e-442618319173NAC domain-containing protein 19
3swp_D4e-442618319173NAC domain-containing protein 19
4dul_A3e-442618316170NAC domain-containing protein 19
4dul_B3e-442618316170NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400001114
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4375220.0KF437522.1 Solanum tuberosum putative membrane bound NAC transcription factor 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001274765.10.0uncharacterized LOC102593794
TrEMBLU5Q2S00.0U5Q2S0_SOLTU; Putative membrane bound NAC transcription factor 1
STRINGPGSC0003DMT4000014980.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33632448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.25e-85TCV-interacting protein
Publications ? help Back to Top
  1. McLellan H, et al.
    An RxLR effector from Phytophthora infestans prevents re-localisation of two plant NAC transcription factors from the endoplasmic reticulum to the nucleus.
    PLoS Pathog., 2013. 9(10): p. e1003670
    [PMID:24130484]