PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400001112
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 401aa    MW: 44895.2 Da    PI: 4.6601
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400001112genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.42.8e-53271551128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           lp+G+rF+Ptdeelv++yL+ k++g + ++ +vi+evdi+k+ePwdLp  + v+++++ew+fF+++d+ky++g+r nrat++gyWkatg
  PGSC0003DMP400001112  27 LPVGYRFRPTDEELVNHYLRLKINGADSQV-SVIREVDICKLEPWDLPdlSVVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATG 114
                           799************************999.99**************96448888999******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           kd+++++kkg+++g+kktLv+y grap+g++t+Wv+heyr+
  PGSC0003DMP400001112 115 KDRNIVTKKGAKIGMKKTLVYYIGRAPEGKRTHWVIHEYRA 155
                           ***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-5922178IPR003441NAC domain
PROSITE profilePS5100555.46227178IPR003441NAC domain
PfamPF023655.8E-2728154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002230Biological Processpositive regulation of defense response to virus by host
GO:0002237Biological Processresponse to molecule of bacterial origin
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MAVLPGENPI AVLPVDKQMG IPPLNTLPVG YRFRPTDEEL VNHYLRLKIN GADSQVSVIR  60
EVDICKLEPW DLPDLSVVES HDNEWFFFCP KDRKYQNGQR LNRATERGYW KATGKDRNIV  120
TKKGAKIGMK KTLVYYIGRA PEGKRTHWVI HEYRATEKSL DGSHPGQGAF VLCRLFRKND  180
LKQDEHVENS NLDAEQNASV DKSPAEDELS EAATPLMVIQ PLSDCDKSYA AKFSKGEMYG  240
KQIPIESHSN SCIADDTEDQ MLDITSIPPV QDLEKELGNF YDPSSQPDWK IFSPLHSQMQ  300
VELGSSYLQA PFNNDICGYQ KDVQFPYGTN ALEINDFLNS ILVNSDELSC EDSGQELASH  360
HIDTKNYSIT GPMIKDSGSC SESEAEVTQG QVSGTMYCIN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-452618316170NO APICAL MERISTEM PROTEIN
1ut4_B1e-452618316170NO APICAL MERISTEM PROTEIN
1ut7_A1e-452618316170NO APICAL MERISTEM PROTEIN
1ut7_B1e-452618316170NO APICAL MERISTEM PROTEIN
3swm_A1e-452618319173NAC domain-containing protein 19
3swm_B1e-452618319173NAC domain-containing protein 19
3swm_C1e-452618319173NAC domain-containing protein 19
3swm_D1e-452618319173NAC domain-containing protein 19
3swp_A1e-452618319173NAC domain-containing protein 19
3swp_B1e-452618319173NAC domain-containing protein 19
3swp_C1e-452618319173NAC domain-containing protein 19
3swp_D1e-452618319173NAC domain-containing protein 19
4dul_A1e-452618316170NAC domain-containing protein 19
4dul_B1e-452618316170NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400001112
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4375220.0KF437522.1 Solanum tuberosum putative membrane bound NAC transcription factor 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001274765.10.0uncharacterized LOC102593794
TrEMBLM0ZIK50.0M0ZIK5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000014980.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.28e-88TCV-interacting protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]