PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400000262
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARF
Protein Properties Length: 686aa    MW: 76550.4 Da    PI: 6.4695
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400000262genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3741.8e-23111211198
                           EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 
                           f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF
  PGSC0003DMP400000262 111 FCKILTASDTSTHGGFSVLRKHANEClpqldmtQ--ATPTQDLVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVF 197
                           99**************************999543..445568*********************************************** PP

                           EE-SSSEE..EEEEE- CS
                    B3  83 kldgrsefelvvkvfr 98 
                              +++++el+v+v+r
  PGSC0003DMP400000262 198 L--RDDNGELRVGVRR 211
                           *..5589999****98 PP

2Auxin_resp101.88.7e-34237316183
            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                           a+ha++t++ F v+Y+Pr+  s+F+v ++k+++a+++ +svGmRf+m+fe+eds+err++Gt+vg+ d+++ +W++SkWrsLk
  PGSC0003DMP400000262 237 ASHAITTQTRFVVYYKPRT--SQFIVGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERRFTGTIVGTGDISS-QWSESKWRSLK 316
                           789***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.26E-39103240IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.1E-40105226IPR015300DNA-binding pseudobarrel domain
CDDcd100178.16E-20109211No hitNo description
SMARTSM010192.3E-21111213IPR003340B3 DNA binding domain
PfamPF023622.4E-21111211IPR003340B3 DNA binding domain
PROSITE profilePS5086312.252111213IPR003340B3 DNA binding domain
PfamPF065071.2E-31237316IPR010525Auxin response factor
PfamPF023099.9E-6562606IPR033389AUX/IAA domain
SuperFamilySSF542776.38E-14565646No hitNo description
PROSITE profilePS5174527.693570662IPR000270PB1 domain
PfamPF023092.0E-7616660IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    Send to blast
MGSEDLYRDL WKACAGPLVD VPRDAERVYY FPQGHIEQLE ASTNQAVNQQ IPQFNLSSKI  60
LCRVVHVQLL AETETDEVYA QITLHPEAEQ EEPSKPDPCP PDLPKRTVHS FCKILTASDT  120
STHGGFSVLR KHANECLPQL DMTQATPTQD LVAKDLHGYE WRFKHIFRGQ PRRHLLTTGW  180
STFVTSKRLV AGDAFVFLRD DNGELRVGVR RLARQQSPIP QSVISSQSMH LGVLATASHA  240
ITTQTRFVVY YKPRTSQFIV GLNKYLEAVS HGFSVGMRFR MRFEGEDSPE RRFTGTIVGT  300
GDISSQWSES KWRSLKIQWD EPASMVRPDR VSPWEIEPFV ASTCVDVAQP GIKSKRPRPL  360
DLPRTEIAVA SAASPFWCPG SGPTLEVSHL GGITDVQSHD NQLFWSSKQN SCLSNGVSNT  420
SCRTHLSGAW QHSMLANGSL NLLRDSIEDN KQLITRSALL DYGSPMSSKA SSGLLHDQVN  480
RGNKREISSG CRLFGIDLRN NSNNTSTKAK EILGPNITSN CADEAPIVHD ESEIDKDQNV  540
EHLNPSDEKK QVQLEALPKD TLKQGPTSSR TRTKVQMQGV RVGRAVDLTA LSGYDDLISE  600
LEKIFDIKGE LCPRNKWEVV YTDDEGDMML VGDDPWLEFC NMVRRIFIYS SEEVKKMTPR  660
CKLPILSLEG EGTMPSVDSE LKAEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-169333916355Auxin response factor 1
4ldw_A1e-169333916355Auxin response factor 1
4ldw_B1e-169333916355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1354358KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400000262
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2331200.0AC233120.6 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-101i8 map 1, complete sequence.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006339723.10.0PREDICTED: auxin response factor 18 isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLM0ZGK30.0M0ZGK3_SOLTU; Auxin response factor
STRINGPGSC0003DMT4000003450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]