PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.3961s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARR-B
Protein Properties Length: 675aa    MW: 73935.6 Da    PI: 6.948
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.3961s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like44.72.9e-142072372555
                 G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              +A+Pk+ilelm+ + Lt+e+v+SHLQkYRl
  SapurV1A.3961s0010.1.p 207 SRAVPKKILELMNAEKLTRENVASHLQKYRL 237
                             59****************************8 PP

2Response_reg77.83.9e-26481561109
                             EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHH CS
            Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeed 85 
                             vl vdD+p+ + ll+++l++ +y +v+++++++ al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g++++
  SapurV1A.3961s0010.1.p  48 VLAVDDDPTCLLLLETLLRRCQY-NVTTTSQATTALRMLRENKnkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDPKL 132
                             799********************.***************888888*******************87754.558************** PP

                             HHHHHHTTESEEEESS--HHHHHH CS
            Response_reg  86 alealkaGakdflsKpfdpeelvk 109
                             + + +  Ga  +l Kp+ +eel +
  SapurV1A.3961s0010.1.p 133 VMKGITHGACYYLLKPVRIEELKT 156
                             *********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.13E-3545171IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.4E-4145181No hitNo description
SMARTSM004485.3E-3246158IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.21347162IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.9E-2348157IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.87E-2349162No hitNo description
SuperFamilySSF466893.58E-7207241IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-13207237IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.6E-14207242IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MPDMDGFKLL ELVGLEMDLP VITLKTLKEN MLAIRDSSIE KFPIGMRVLA VDDDPTCLLL  60
LETLLRRCQY NVTTTSQATT ALRMLRENKN KFDLVISDVH MPDMDGFKLL ELVGLEMDLP  120
VIMLSANGDP KLVMKGITHG ACYYLLKPVR IEELKTIWQH LIRRKKSDNK DRNSLDNRDK  180
PDQGSSEAVP EQKLNKKRKD QNGDEDSRAV PKKILELMNA EKLTRENVAS HLQKYRLYLK  240
RISTVANQQA NRVAALGSSD ASYLQINSMS RLGLHNLAGS AQFHSTPFRS LPSSGMLDRL  300
NSPPVLGIHG LPSPGVIQLG HVQTAPHYAN GPSHFQTAGH PGNNGNLLQG MPMPLELDQI  360
QSNKGENYIQ ELPTHLGDTA SFPVSSGSTD LKIIAGSSNS PFVDVSNKHL ILEEHGQGLQ  420
DGQKFGKKSS LSAGSLNPRY SSNFPDHGRC NDNWSNAVQS NGVQSNSLTL NDCFKRSILH  480
PSAIRESMST MALQSRNNPC DVSSISTLPI HLQDSKADLP CQVGVATVSS NAGQLINNGP  540
LGWDDHRQDD PYHSNGLSNS INSAIPINGN GNPNGCNLDA NSLFFQRTTR FSSTGLSNFV  600
DTSLMKHNEV ECSAMETLVR SRDGYLPSQE KPQDGSVLNN FGSLEDLVSV MKQDKVKLPE  660
GDFGCGGYSL KTCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jte_A8e-13471665125Response regulator receiver protein
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.3961s0010.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081440.0FN908144.1 Populus x canadensis mRNA for putative B-type response regulator 22 (rr22 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024446134.10.0two-component response regulator ARR12 isoform X2
TrEMBLA0A2K1WUJ00.0A0A2K1WUJ0_POPTR; Two-component response regulator
STRINGPOPTR_0018s02330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-100response regulator 12