PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.3520s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TCP
Protein Properties Length: 378aa    MW: 40548.4 Da    PI: 7.0517
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.3520s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP24.11.1e-0732742062
                     TCP 20 RRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikel 62
                             R++++a c   ++ + deLG+ +  +ti WL +  k +    
  SapurV1A.3520s0020.1.p 32 VRICMPAICSPAIYRIKDELGLASCEETIYWLVRHTKSSKTRP 74
                            59********************************999876654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF563171.44E-36116343IPR003010Carbon-nitrogen hydrolase
Gene3DG3DSA:3.60.110.106.9E-31117271IPR003010Carbon-nitrogen hydrolase
PROSITE profilePS5026322.246118377IPR003010Carbon-nitrogen hydrolase
PfamPF007956.2E-31119284IPR003010Carbon-nitrogen hydrolase
Gene3DG3DSA:3.60.110.104.5E-7272342IPR003010Carbon-nitrogen hydrolase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006807Biological Processnitrogen compound metabolic process
GO:0016810Molecular Functionhydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MEEEFAKKAE VKQVKKRGPR PLIVAQSQAK NVRICMPAIC SPAIYRIKDE LGLASCEETI  60
YWLVRHTKSS KTRPIRETDS VDHDSVSKPA CMANPDGDMP AYDFLPTAGG VPTARSPVRA  120
TVVQASTMFF DTPATLDKAE RLIAGAAAYG SQLVVFPEAF IGGSPTYLKF DATNSTVTDG  180
DLQKYYASAI DVPGPEVDRL AKLAGKYKVH IVMGVVERAG CYLYSTMMFF DSLGKCLGLH  240
RKLIQTASES SLWRSGEKST MPAYETSIGK IVAANQFCKR RDYPLPPGDV NGDASLDDIT  300
CAGGSVIISP SGTILAGPDY QGECFISADL DLGHIVLAKT QFGGIESVVD KNHVGAAANG  360
SEPNLFASEM KTKALQK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3wuy_A1e-1611827316169Nitrilase
3wuy_B1e-1611827316169Nitrilase
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtHighly specific for beta-cyano-L-alanine (Ala(CN)). Low activity with 3-phenylpropionitrile (PPN). Not associated with auxin production but may be involved in cyanide detoxification. {ECO:0000269|PubMed:10574458, ECO:0000269|PubMed:11060302}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.3520s0020.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by abscisic acid or by 1-aminocyclopropane-1-carboxylic acid (ACC). {ECO:0000269|PubMed:10574458}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2852803e-77GU285280.1 Populus balsamifera isolate KUU07 haplotype A nitrilase 4 gene, partial sequence.
GenBankGU2852813e-77GU285281.1 Populus balsamifera isolate KUU07 haplotype B nitrilase 4 gene, partial sequence.
GenBankGU2852823e-77GU285282.1 Populus balsamifera isolate MGR10 haplotype A nitrilase 4 gene, partial sequence.
GenBankGU2852833e-77GU285283.1 Populus balsamifera isolate MGR10 haplotype B nitrilase 4 gene, partial sequence.
GenBankGU2852843e-77GU285284.1 Populus balsamifera isolate NWL07 haplotype A nitrilase 4 gene, partial sequence.
GenBankGU2852853e-77GU285285.1 Populus balsamifera isolate NWL07 haplotype B nitrilase 4 gene, partial sequence.
GenBankGU2852863e-77GU285286.1 Populus balsamifera isolate POR11 haplotype A nitrilase 4 gene, partial sequence.
GenBankGU2852873e-77GU285287.1 Populus balsamifera isolate POR11 haplotype B nitrilase 4 gene, partial sequence.
GenBankGU2852883e-77GU285288.1 Populus balsamifera isolate RNA13 haplotype A nitrilase 4 gene, partial sequence.
GenBankGU2852893e-77GU285289.1 Populus balsamifera isolate RNA13 haplotype B nitrilase 4 gene, partial sequence.
GenBankGU2852903e-77GU285290.1 Populus balsamifera isolate STL13 haplotype A nitrilase 4 gene, partial sequence.
GenBankGU2852913e-77GU285291.1 Populus balsamifera isolate STL13 haplotype B nitrilase 4 gene, partial sequence.
GenBankGU2852923e-77GU285292.1 Populus balsamifera isolate STO11 haplotype A nitrilase 4 gene, partial sequence.
GenBankGU2852933e-77GU285293.1 Populus balsamifera isolate STO11 haplotype B nitrilase 4 gene, partial sequence.
GenBankGU2852943e-77GU285294.1 Populus balsamifera isolate WHR03 haplotype A nitrilase 4 gene, partial sequence.
GenBankGU2852953e-77GU285295.1 Populus balsamifera isolate WHR03 haplotype B nitrilase 4 gene, partial sequence.
GenBankGU2852963e-77GU285296.1 Populus balsamifera isolate LOV02 haplotype A nitrilase 4 gene, partial sequence.
GenBankGU2852973e-77GU285297.1 Populus balsamifera isolate LOV02 haplotype B nitrilase 4 gene, partial sequence.
GenBankGU2852983e-77GU285298.1 Populus balsamifera isolate GIL14 haplotype A nitrilase 4 gene, partial sequence.
GenBankGU2852993e-77GU285299.1 Populus balsamifera isolate GIL14 haplotype B nitrilase 4 gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322807.30.0bifunctional nitrilase/nitrile hydratase NIT4B
SwissprotQ429662e-83NRL4B_TOBAC; Bifunctional nitrilase/nitrile hydratase NIT4B
TrEMBLA0A2K1XC700.0A0A2K1XC70_POPTR; Uncharacterized protein
STRINGPOPTR_0016s07510.11e-177(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1789636
Publications ? help Back to Top
  1. Dohmoto M,Sano J,Tsunoda H,Yamaguchi K
    Structural analysis of the TNIT4 genes encoding nitrilase-like protein from tobacco.
    DNA Res., 1999. 6(5): p. 313-7
    [PMID:10574458]
  2. Piotrowski M,Schönfelder S,Weiler EW
    The Arabidopsis thaliana isogene NIT4 and its orthologs in tobacco encode beta-cyano-L-alanine hydratase/nitrilase.
    J. Biol. Chem., 2001. 276(4): p. 2616-21
    [PMID:11060302]