PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.2860s0030.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 173aa    MW: 18292.6 Da    PI: 6.3351
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.2860s0030.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26031.93.7e-1031705897
                  DUF260 58 msslvyeAearardPvyGavgvilklqqqleqlkaelall 97
                            + sl++eA+ r+ +Pv+Gavg++++++++++q+++e++l 
  SapurV1A.2860s0030.2.p 31 ALSLLFEACGRTVNPVNGAVGLLWSGNWHVCQEAVETVLS 70
                            569*******************************998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575120No hitNo description
PfamPF031956.3E-63168IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MPKVTLPCFS PNFLAVVISC LSSPPYPNPN ALSLLFEACG RTVNPVNGAV GLLWSGNWHV  60
CQEAVETVLS GGALRPLHGI LTGFLAPNCD ESSDGFSAAV HDMAWNQSKS FAKESNNEVV  120
SDHHVNPCLA RGIGGRGKRG REAVSFYTGG ESETISFESS GGDQKRLLNL FV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.2860s0030.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301153.31e-82LOB domain-containing protein 39
SwissprotQ9SZE86e-24LBD39_ARATH; LOB domain-containing protein 39
TrEMBLA0A1L6K5D32e-82A0A1L6K5D3_POPTO; LOB domain-containing protein 39-like
STRINGPOPTR_0002s12020.13e-81(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37540.12e-26LOB domain-containing protein 39