PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.2394s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LFY
Protein Properties Length: 376aa    MW: 42471.1 Da    PI: 8.2045
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.2394s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY620.52.9e-18913601385
                 FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeeld 87 
                             mdpeaf+aslfkwd+ra++ + p+rlle  a +++p +aa a+  r+l +leelf+ayG+ry+t+akiaelGftv+tL+dmkdeeld
  SapurV1A.2394s0010.1.p   1 MDPEAFTASLFKWDTRAMV-PHPNRLLEMVAPPQQPPAAAFAVRPRELCGLEELFQAYGIRYYTAAKIAELGFTVNTLLDMKDEELD 86 
                             9**************9766.77789998888888887888888888999************************************** PP

                 FLO_LFY  88 dlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelv 174
                             ++m+sls+ifr+dllvGeryGikaavraerrrl+ee+   +rr+lls d+ ++ldalsqeg seepvq+ keaagsgg+g  ++e+v
  SapurV1A.2394s0010.1.p  87 EMMNSLSQIFRWDLLVGERYGIKAAVRAERRRLDEED--PRRRQLLSGDT-NTLDALSQEGFSEEPVQQDKEAAGSGGRG--TWEAV 168
                             ***********************************88..99999999996.57***********************9998..99999 PP

                 FLO_LFY 175 aaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCre 261
                             +a e      +kk+     ++k ++++    d       d d+e +g    erqrehPfivtepgevargkknGLDYLf+LyeqCr+
  SapurV1A.2394s0010.1.p 169 TAGE------RKKQ-P--GRKKGHRKV---VD------LDGDDE-HGGAICERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCRD 236
                             9883......3333.1..222222221...11......122233.344467************************************ PP

                 FLO_LFY 262 fLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaia 348
                             fL+qvq+iakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLde+asnalrrafkergenvGawrqacykplvaia
  SapurV1A.2394s0010.1.p 237 FLIQVQNIAKERGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEDASNALRRAFKERGENVGAWRQACYKPLVAIA 323
                             *************************************************************************************** PP

                 FLO_LFY 349 arqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                             +rqgwdid++fnahprL+iWYvPtkLrqLC++er+ a
  SapurV1A.2394s0010.1.p 324 SRQGWDIDSIFNAHPRLAIWYVPTKLRQLCYAERNGA 360
                             **********************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016984.2E-2031360IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MDPEAFTASL FKWDTRAMVP HPNRLLEMVA PPQQPPAAAF AVRPRELCGL EELFQAYGIR  60
YYTAAKIAEL GFTVNTLLDM KDEELDEMMN SLSQIFRWDL LVGERYGIKA AVRAERRRLD  120
EEDPRRRQLL SGDTNTLDAL SQEGFSEEPV QQDKEAAGSG GRGTWEAVTA GERKKQPGRK  180
KGHRKVVDLD GDDEHGGAIC ERQREHPFIV TEPGEVARGK KNGLDYLFHL YEQCRDFLIQ  240
VQNIAKERGE KCPTKVTNQV FRYAKKAGAS YINKPKMRHY VHCYALHCLD EDASNALRRA  300
FKERGENVGA WRQACYKPLV AIASRQGWDI DSIFNAHPRL AIWYVPTKLR QLCYAERNGA  360
TASSSVSGTG VHLPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1072013704185PROTEIN LEAFY
2vy2_A1e-1072013704185PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.2394s0010.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2308170.0AY230817.1 Salix discolor leafy/floricaula mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011040286.10.0PREDICTED: floricaula/leafy homolog
SwissprotO040640.0FLLH_POPTR; Floricaula/leafy homolog
TrEMBLQ84L920.0Q84L92_SALDS; Leafy/floricaula
STRINGPOPTR_0015s11820.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80333346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-151floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Tuskan GA, et al.
    The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
    Science, 2006. 313(5793): p. 1596-604
    [PMID:16973872]