PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.2089s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family B3
Protein Properties Length: 373aa    MW: 42968.9 Da    PI: 9.1617
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.2089s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.31e-11596198
                            EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                      B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89
                            ff++l+ +++ + +rl++p +f++++g++      ++l  + g + ++ l   k ++++++ +GW++Fv+   +  g f++F+++g+  
  SapurV1A.2089s0010.1.p  5 FFQKLILPSTIRDKRLRIPDSFVKKFGQD--LLGFVRLIVPGGHVSRIGL--IKADEKIWFHDGWQQFVERFTIHIGYFLIFRYEGNAI 89
                            889999999999**************877..4447***************..9*******************************99888 PP

                            E..EEEEE- CS
                      B3 90 felvvkvfr 98
                            f  +v++f+
  SapurV1A.2089s0010.1.p 90 F--NVHIFN 96
                            8..888875 PP

2B361.21.7e-19277367498
                             E-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                      B3   4 vltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                             vl ps+  + ++++lp  fae++  g     s  ++l+ ++g++W v++ yr+++    +++GW eF ++n+L egD+++F+l +++
  SapurV1A.2089s0010.1.p 277 VLRPSYLYRGCIMYLPSGFAEKNlnG----LSGFMKLQLPDGKQWPVRCLYRGGR--AKFSQGWYEFTQENNLGEGDVCIFELLKSR 357
                             78899******************643....34469999***********666665..5699*********************99988 PP

                             EE..EEEEE- CS
                      B3  89 efelvvkvfr 98 
                             +  l+v+vfr
  SapurV1A.2089s0010.1.p 358 DVVLKVTVFR 367
                             8889999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.2E-19396IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.67E-19396IPR015300DNA-binding pseudobarrel domain
CDDcd100177.96E-15496No hitNo description
PROSITE profilePS5086310.419598IPR003340B3 DNA binding domain
PfamPF023628.0E-9596IPR003340B3 DNA binding domain
SMARTSM010192.4E-12698IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-25266367IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.73E-25268367IPR015300DNA-binding pseudobarrel domain
CDDcd100171.07E-23272367No hitNo description
SMARTSM010195.5E-22274369IPR003340B3 DNA binding domain
PROSITE profilePS5086314.043274369IPR003340B3 DNA binding domain
PfamPF023621.4E-17277367IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description