PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1835s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 245aa    MW: 27443.7 Da    PI: 8.3729
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1835s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260111.75.2e-3519115197
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             aCa+Ck++r++C+++C+lapyfpae++ +f++vhk+FG+snv+kl+k++  e+r+++++slv+eA +r++dP+ G++g +++l+++ 
  SapurV1A.1835s0030.1.p  19 ACASCKHQRKRCTENCALAPYFPAEKTLEFQAVHKVFGVSNVVKLVKNVIAERRKETVDSLVWEALCRQNDPILGCYGKLKRLKEEF 105
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelall 97 
                             ++ +++  +l
  SapurV1A.1835s0030.1.p 106 DSYRTQHPSL 115
                             9998876555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.23518120IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-3319112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MQRGSNSSNI NNRMLAHPAC ASCKHQRKRC TENCALAPYF PAEKTLEFQA VHKVFGVSNV  60
VKLVKNVIAE RRKETVDSLV WEALCRQNDP ILGCYGKLKR LKEEFDSYRT QHPSLNQNQL  120
GQHHGSVVFN SKQSPTMVSR TNNRGNGIGG GLASNNMASY DNEKMNFDSI QHSYHWNYVQ  180
STLDISKQER DASSLLLLQS PPPPPPLPQH HSFNGFNQQQ YYLPGEFGSM DSTLFIGSEE  240
DPSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-222012112120LOB family transfactor Ramosa2.1
5ly0_B9e-222012112120LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.1835s0030.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024446755.11e-109LOB domain-containing protein 2
SwissprotQ9LNB92e-37LBD2_ARATH; LOB domain-containing protein 2
TrEMBLA0A3N7HDC41e-108A0A3N7HDC4_POPTR; Uncharacterized protein
STRINGPOPTR_0019s12200.13e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127222534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.19e-39LOB domain-containing protein 2