PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1496s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Trihelix
Protein Properties Length: 300aa    MW: 35305.8 Da    PI: 8.8068
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1496s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix81.89.1e-2642123186
                trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                             +W  qe+++ i +r e+e+++  +k++k+lWe vs+kmre+g++r+p+qCk+kw+nl +ryk  ++++ +    + ++cp+f++l+
  SapurV1A.1496s0030.1.p  42 QWGLQETKEFIGIRAELEKDFTVTKRNKTLWEIVSAKMREKGYRRTPEQCKCKWKNLVNRYKGKETSDPE----TGRQCPFFEELH 123
                             7**************************************************************9999997....4678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.2243599IPR017877Myb-like domain
PfamPF138377.9E-2341124No hitNo description
CDDcd122037.26E-2343106No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MMFSGGGEGD TGLGRINMMP TAAMLSPSAE VSPRGPPQQQ PQWGLQETKE FIGIRAELEK  60
DFTVTKRNKT LWEIVSAKMR EKGYRRTPEQ CKCKWKNLVN RYKGKETSDP ETGRQCPFFE  120
ELHAVFTERA KNMQRLFLES EAGSTQSRKK VKKTSGDRSS DEFSEEEDED DDDSEEEKPV  180
KSNSRKRKVE KIKVEKSPRA SSSTGGGIQE MLKEFLQQQQ KMEMQWREMM ERRSHERQLF  240
EQEWRQSMEK LERERLMIEQ AWRDREEQRR IREESRAERR DALLTTLLNK LIRENKIEN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011018396.11e-156PREDICTED: trihelix transcription factor GT-3b-like
TrEMBLU5GMR31e-156U5GMR3_POPTR; Uncharacterized protein
STRINGPOPTR_0003s10360.11e-147(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.17e-33Trihelix family protein