PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1483s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family G2-like
Protein Properties Length: 414aa    MW: 45836.9 Da    PI: 8.8413
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1483s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.9e-32222275255
                 G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                             pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  SapurV1A.1483s0070.1.p 222 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 275
                             9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15219275IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28220275IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23222275IPR006447Myb domain, plants
PfamPF002497.4E-7223274IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MRSDSQAYIE LSLAHPATGL DEESRRNLSS ARVEELPHNP YRQKSHHHQH LHRSNGTTHH  60
LNHINHGVSL LEVSDSFRPI KGIPVYHNRS FPFMPLEHSS RENKDSKRGF YQMPYPSSSL  120
CSPSVNPHSS SSTSSPYSIG GGGLDPMSML NSSGPNQALP GPYSRLAPAT RFNGLSMDAF  180
KSHHLHHHHN QYGVGSTEGS PHGLIRSRFL PKLPTKRSMR APRMRWTSTL HARFVHAVEL  240
LGGHERATPK SVLELMDVKD LTLAHVKSHL QMYRTVKTTD KPAASSDGSG EEDMSPIGSF  300
STANERGGLL RVVQPDGPTV QLDVDYPPST TSAATTLWSN SSSGREAWSQ ANSNDMDGHR  360
QETFQPQQRS GQQMEECNST RLKSYLGSSN MDCKNPSLEF TLGRPDWQGK EHC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A8e-16223277357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-16223277357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-16223277357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-16223277357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.1483s0070.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142140.0AC214214.1 Populus trichocarpa clone POP028-A01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024444406.10.0transcription repressor KAN1-like
TrEMBLA0A2K1X7N10.0A0A2K1X7N1_POPTR; Uncharacterized protein
STRINGPOPTR_0017s02220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-83G2-like family protein