PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1378s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Trihelix
Protein Properties Length: 298aa    MW: 34611 Da    PI: 8.6273
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1378s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix69.56.5e-2243124186
                trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                             +W  +e+++ i +r e++e++  +k++ +lWe vs++m e+g++r+p+qCk+kw+nl++ yk  ++ + +    + ++c +f++l+
  SapurV1A.1378s0050.1.p  43 QWGLRETKEFIGIRAELKEDFTVTKRNRTLWEMVSARMGEKGYRRTPEQCKCKWKNLANLYKGKETPDPE----TGRQCLFFEELH 124
                             7*************************************************************99988886....467899**9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.7636100IPR017877Myb-like domain
CDDcd122037.45E-2142107No hitNo description
PfamPF138372.1E-1842125No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MRFRSGGGEG GAGLGPINMM PTEAMLSPKA EISPRGPPLL QPQWGLRETK EFIGIRAELK  60
EDFTVTKRNR TLWEMVSARM GEKGYRRTPE QCKCKWKNLA NLYKGKETPD PETGRQCLFF  120
EELHEVFTDR DKNRQRVLLE SEAGSTRSRK KARRIDGDRS SDEFSDEDEV ESEEEKPAGS  180
NSRKRKGGKT VAEKTPRASG SAADGCAQEM LKDFFQQQLV MEMQWRELME KRAHERQMAE  240
QEWRRSMDKL ERERLTIEQA WREREEQRRI RGESRAERRD ALLTTLLNKL IDENDHM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002304391.21e-135hypothetical protein POPTR_0003s10360g
TrEMBLB9GZY21e-135B9GZY2_POPTR; Uncharacterized protein
STRINGPOPTR_0003s10360.11e-135(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.12e-36Trihelix family protein