PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1260s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HD-ZIP
Protein Properties Length: 309aa    MW: 35113.2 Da    PI: 6.754
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1260s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.2e-1895147456
                             -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  SapurV1A.1260s0050.1.p  95 KKRLNLEQVKALEKSFEVGNKLEPERKLQLAKALGLQPRQIAIWFQNRRARWK 147
                             4568889*********************************************9 PP

2HD-ZIP_I/II128.62.5e-4193184192
             HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeL 87 
                             ekk+rl+ eqvk+LE+sFe  +kLeperK +la++Lglqprq+a+WFqnrRAR+ktkqlEkdye Lk+++d+lk++n++L++++++L
  SapurV1A.1260s0050.1.p  93 EKKKRLNLEQVKALEKSFEVGNKLEPERKLQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYEILKKQFDSLKADNDALQAQNKKL 179
                             69************************************************************************************* PP

             HD-ZIP_I/II  88 reelk 92 
                             ++el 
  SapurV1A.1260s0050.1.p 180 HAELL 184
                             *9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.98E-1985151IPR009057Homeodomain-like
PROSITE profilePS5007116.89289149IPR001356Homeobox domain
SMARTSM003891.1E-1792153IPR001356Homeobox domain
CDDcd000861.08E-1594150No hitNo description
PfamPF000464.2E-1595147IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-1897156IPR009057Homeodomain-like
PRINTSPR000311.6E-5120129IPR000047Helix-turn-helix motif
PROSITE patternPS000270124147IPR017970Homeobox, conserved site
PRINTSPR000311.6E-5129145IPR000047Helix-turn-helix motif
PfamPF021833.4E-15149187IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MNERSFALRE PHYHHHMAFP PHHGFMFHSH EDDDHHPSPS SLNSLPSFPP QLFPGGGGQF  60
LLKRSMSFSG MEKCEEVGNG EDDLSDDGSQ IGEKKKRLNL EQVKALEKSF EVGNKLEPER  120
KLQLAKALGL QPRQIAIWFQ NRRARWKTKQ LEKDYEILKK QFDSLKADND ALQAQNKKLH  180
AELLSLKIRE SNEVNLKKET EGSWSNGSEN SCDVNIDISR NPVASSPVSS HLTTKHLFST  240
SIRPASITQL LQGSSRSDLQ CLKVDQLVHQ DENFCSMFNG MEEQQGFWSW PEQQNATFSL  300
NQVQFSNN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141149RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.1260s0050.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011013796.10.0PREDICTED: homeobox-leucine zipper protein HAT7-like
SwissprotQ004665e-87HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLB9IJW40.0B9IJW4_POPTR; Uncharacterized protein
STRINGPOPTR_0017s11800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.13e-77HD-ZIP family protein