PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1247s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 186aa    MW: 20279.8 Da    PI: 6.4966
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1247s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.95.4e-4610108199
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++lp+++reda++sl+yeAear+rdPvyG+vg i+ lq+q+
  SapurV1A.1247s0030.1.p  10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELPPHQREDAVNSLAYEAEARVRDPVYGCVGAITFLQRQV 96 
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallke 99 
                             ++l++el+++++
  SapurV1A.1247s0030.1.p  97 QRLQKELDAANS 108
                             *******99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089128.249110IPR004883Lateral organ boundaries, LOB
PfamPF031958.6E-4510107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MASSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELPP  60
HQREDAVNSL AYEAEARVRD PVYGCVGAIT FLQRQVQRLQ KELDAANSDL IHYACSEIPT  120
ALPAPPGPSS IQSMAPRQRP IDHYDRIGMG NEGGYYEAPS FPTPYNLPWN DNLSGDNNAG  180
GGSNM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-7181239127LOB family transfactor Ramosa2.1
5ly0_B3e-7181239127LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.1247s0030.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4477195e-99AM447719.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X240773.7, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322187.21e-114protein LATERAL ORGAN BOUNDARIES
RefseqXP_011046208.11e-114PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_011046209.11e-114PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_024442234.11e-114protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FML41e-72LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLB9IEW91e-113B9IEW9_POPTR; Uncharacterized protein
STRINGPOPTR_0015s09370.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.44e-75LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]