PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1019s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 184aa    MW: 20138.9 Da    PI: 8.6257
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1019s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.81.9e-3851041100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             aCaaC+++rr+C++dC+lap fp e++k+f+++hklFG++n++  lk++ +e++++ ++s+vyeA+ar+rdPv+G++g+i++l q++
  SapurV1A.1019s0050.1.p   5 ACAACRHQRRRCTPDCPLAPFFPPEKTKDFEAAHKLFGVHNIVINLKKTTPEQKPESITSMVYEANARVRDPVSGCTGIISRLLQNI 91 
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             + +k+el+ ++++
  SapurV1A.1019s0050.1.p  92 NAVKVELEFVQAQ 104
                             ********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.7934105IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-365102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MKPPACAACR HQRRRCTPDC PLAPFFPPEK TKDFEAAHKL FGVHNIVINL KKTTPEQKPE  60
SITSMVYEAN ARVRDPVSGC TGIISRLLQN INAVKVELEF VQAQVACFHT LQQQLGGRNA  120
VDNSPQQLQE SSFAQATKLF DGVHQGTFLS IGQPAVKPER HPSSSSSKVH GKQPLHDVSD  180
DGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-25611712121LOB family transfactor Ramosa2.1
5ly0_B1e-25611712121LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.1019s0050.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011008586.11e-103PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
TrEMBLA0A3N7HWH51e-100A0A3N7HWH5_POPTR; Uncharacterized protein
STRINGPOPTR_0018s05240.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2826433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-23LBD family protein