PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0998s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HD-ZIP
Protein Properties Length: 346aa    MW: 38387 Da    PI: 8.5965
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0998s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox551.4e-17175229256
                             T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  SapurV1A.0998s0020.1.p 175 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 229
                             778899***********************************************98 PP

2HD-ZIP_I/II127.94.3e-41175265192
             HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeL 87 
                             +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eL
  SapurV1A.0998s0020.1.p 175 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQEL 261
                             69************************************************************************************* PP

             HD-ZIP_I/II  88 reelk 92 
                             r +lk
  SapurV1A.0998s0020.1.p 262 R-ALK 265
                             9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.3E-547137IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.1E-17159225IPR009057Homeodomain-like
SuperFamilySSF466892.35E-18167232IPR009057Homeodomain-like
PROSITE profilePS5007117.216171231IPR001356Homeobox domain
SMARTSM003897.3E-16173235IPR001356Homeobox domain
CDDcd000862.47E-15175232No hitNo description
PfamPF000464.4E-15175229IPR001356Homeobox domain
PROSITE patternPS000270206229IPR017970Homeobox, conserved site
SMARTSM003404.5E-26231274IPR003106Leucine zipper, homeobox-associated
PfamPF021837.0E-11231265IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MELALTLGDT SKPFNFLDKT PRLSSKDLGF CMGLGSGFPA TTRSQDKLGS HESNYQDDER  60
RVSSDPPLQL DLLPFSPVPR RHQAPSKIRF PWLADNLVSD PGSTESPGRG FDVNRLSMED  120
ADEGAAISSP NSAASSFQMD FAIRSGSDRK RDLEAIDAER ASSRASDDEE NGSTRKKLRL  180
SKEQSAFLEE SFKEHNTLNP KQKLALAKQL NLRPRQVEVW FQNRRARTKL KQTEVDCEYL  240
KRCCETLTEE NRRLQKELQE LRALKTSQPF YMQLPATTLT MCPSCERVAT TTTSSSGTTT  300
TTTNPSTTTT PSATTTTSTT ISKPRLFPLS HGQLHPPTKL LHGSL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173179TRKKLRL
2223231RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0998s0020.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM2629441e-127AM262944.1 Phillyrea latifolia partial mRNA for type II homeodomain-leucine zipper protein precursor (ophh-61B gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322729.20.0homeobox-leucine zipper protein HOX11
SwissprotP466651e-101HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLB9IIA10.0B9IIA1_POPTR; HD-ZIP family protein
STRINGPOPTR_0016s05890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-77homeobox from Arabidopsis thaliana