PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0985s0080.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB_related
Protein Properties Length: 345aa    MW: 37555.8 Da    PI: 9.9098
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0985s0080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.52.7e-1283127147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                             r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  SapurV1A.0985s0080.1.p  83 RESWTEPEHDKFLEALQLFDRD-WKKIGAFIG-SKTIIQIRSHAQKY 127
                             789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-1577133IPR009057Homeodomain-like
PROSITE profilePS5129414.57478132IPR017930Myb domain
TIGRFAMsTIGR015572.2E-1781130IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.1E-681133IPR009057Homeodomain-like
SMARTSM007172.1E-982130IPR001005SANT/Myb domain
PfamPF002495.6E-1083127IPR001005SANT/Myb domain
CDDcd001672.66E-785128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MQNPLIQTLK TPQQKPISST SMVSKNPNPA DGSYLDPTGM AALPGLSPFA TTTTPLTTTT  60
TSSSTSEDPS KKIRKPYTIT KSRESWTEPE HDKFLEALQL FDRDWKKIGA FIGSKTIIQI  120
RSHAQKYFLK VQKSGTNEHL PPPRPKRKAT HPYPQKASKN AIVPSQPSDA FQSSSAPLEP  180
GYVLRPDSSS IPVDPIPSAA VASSWTNNVP TVSLSNQTKG PVAANNCCNG TESTPRTKLT  240
GKTAEQGNHG HSMRVLPDFS QVYGFIGSVF DPNVTDQLQN LKKMDPIDVE TVLLLMRNLS  300
LNLNSPSFEE HVSALLKKQF CVLFTAVSPV QVLIISRIRV CACT*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0985s0080.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002305938.20.0protein REVEILLE 6
SwissprotQ8H0W31e-119RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A3N7EYR60.0A0A3N7EYR6_POPTR; Uncharacterized protein
STRINGPOPTR_0004s07160.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-104MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]