PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0979s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family B3
Protein Properties Length: 433aa    MW: 50021.2 Da    PI: 9.4598
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0979s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B335.71.5e-1165156198
                             EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                             ff++l+ +++ + +rl++p +f++++g++      ++l  + g + ++ l   k +++ ++ +GW++Fv+   +  g f++F+++g+
  SapurV1A.0979s0040.1.p  65 FFQKLILPSTIRDKRLRIPDSFVKKFGHD--LLGFVRLIVPGGHVSRIGL--IKADEKLWFHDGWQQFVERFTIHIGYFLIFRYEGN 147
                             888999999999**************988..4457***************..9*******************************998 PP

                             SEE..EEEEE- CS
                      B3  88 sefelvvkvfr 98 
                               f  +v++f+
  SapurV1A.0979s0040.1.p 148 AIF--NVHIFN 156
                             888..888875 PP

2B360.82.2e-19337427498
                             E-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                      B3   4 vltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                             vl ps+  + ++++lp  fae++  g     s  ++l+ ++g++W v++ yr+++    +++GW eF ++n+L egD+++F+l +++
  SapurV1A.0979s0040.1.p 337 VLRPSYLYRGCIMYLPSGFAEKNlnG----LSGFMKLQLPDGKQWPVRCLYRGGR--AKFSQGWYEFTQENNLGEGDVCIFELLKSR 417
                             78899******************643....34469999***********666665..5699*********************99988 PP

                             EE..EEEEE- CS
                      B3  89 efelvvkvfr 98 
                             +  l+v+vfr
  SapurV1A.0979s0040.1.p 418 DVVLKVTVFR 427
                             8889999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.94E-1960156IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.6E-1960156IPR015300DNA-binding pseudobarrel domain
CDDcd100173.89E-1564156No hitNo description
PROSITE profilePS5086310.36265158IPR003340B3 DNA binding domain
PfamPF023621.5E-865156IPR003340B3 DNA binding domain
SMARTSM010191.9E-1266158IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-25326427IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-25328427IPR015300DNA-binding pseudobarrel domain
CDDcd100172.33E-23332427No hitNo description
PROSITE profilePS5086314.043334429IPR003340B3 DNA binding domain
SMARTSM010195.5E-22334429IPR003340B3 DNA binding domain
PfamPF023621.9E-17337427IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MIDFHIEKER TEKQCCVRKG ADLKSKKLIF QVDLYHYVNA QSRSLPPTIL VSQYPKPQIK  60
MPRPFFQKLI LPSTIRDKRL RIPDSFVKKF GHDLLGFVRL IVPGGHVSRI GLIKADEKLW  120
FHDGWQQFVE RFTIHIGYFL IFRYEGNAIF NVHIFNLPTS EINYHSNSLC GKRYVAFEEL  180
EDDDRAGIPT TQLIVNKSYN PPALHNLFSG SKLNNGINWG GEENMRLTKS ANVSQVADEW  240
AQNVFAQYNE HKNSQDEVKL YSPDEETPKL KKRGRKRLKI DPNEQQLSSL NEDDGEARFR  300
FYESASARKR TVTAEERERA MNAAKAYAPD NPYCRVVLRP SYLYRGCIMY LPSGFAEKNL  360
NGLSGFMKLQ LPDGKQWPVR CLYRGGRAKF SQGWYEFTQE NNLGEGDVCI FELLKSRDVV  420
LKVTVFRVLE DV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A3e-7230043215146B3 domain-containing transcription factor VRN1
4i1k_B3e-7230043215146B3 domain-containing transcription factor VRN1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the regulation of vernalization. Acts as transcriptional repressor of FLC, a major target of the vernalization pathway. Binds DNA in vitro in a non-sequence-specific manner. {ECO:0000269|PubMed:12114624}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0979s0040.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011005670.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X1
SwissprotQ8L3W11e-137VRN1_ARATH; B3 domain-containing transcription factor VRN1
TrEMBLA0A2K2AUR80.0A0A2K2AUR8_POPTR; Uncharacterized protein
STRINGPOPTR_0004s15400.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-133B3 family protein
Publications ? help Back to Top
  1. Mantegazza O, et al.
    Analysis of the arabidopsis REM gene family predicts functions during flower development.
    Ann. Bot., 2014. 114(7): p. 1507-15
    [PMID:25002525]
  2. Kumar A,Singh A,Panigrahy M,Sahoo PK,Panigrahi KCS
    Carbon nanoparticles influence photomorphogenesis and flowering time in Arabidopsis thaliana.
    Plant Cell Rep., 2018. 37(6): p. 901-912
    [PMID:29541883]