PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0884s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 245aa    MW: 28427.4 Da    PI: 9.2681
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0884s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.31.3e-30959151
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+ey++
  SapurV1A.0884s0020.1.p  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYAT 59
                            79***********************************************86 PP

2K-box108.19.8e-368517510100
                   K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                             + +++ s++ e+akLk++++ L r+qRh++GedLesL++keLq+Le+q++ +lk++Rs+Kn+l++e+i+elqkk k+lqe+n++L k
  SapurV1A.0884s0020.1.p  85 DPENQGSWTLEYAKLKARVDVLHRNQRHFMGEDLESLNIKELQNLENQIDAALKHVRSRKNQLMYESISELQKKDKALQEQNNMLAK 171
                             4567889******************************************************************************** PP

                   K-box  97 klee 100
                             k++e
  SapurV1A.0884s0020.1.p 172 KVKE 175
                             *986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.73161IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-40160IPR002100Transcription factor, MADS-box
CDDcd002652.84E-43279No hitNo description
SuperFamilySSF554559.55E-34283IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-31323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-2988173IPR002487Transcription factor, K-box
PROSITE profilePS5129716.90389179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010154Biological Processfruit development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGRGRIQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLFEYATD  60
SCMERILERY ERYSYAERQL LANDDPENQG SWTLEYAKLK ARVDVLHRNQ RHFMGEDLES  120
LNIKELQNLE NQIDAALKHV RSRKNQLMYE SISELQKKDK ALQEQNNMLA KKVKEKEKAI  180
IAQQALWEQQ NPDLDSPSIH RPQPQQPLNI SSSHLATGIE EEPTPIQHRA NALLPAWMLR  240
YLNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q1e-22174173Myocyte-specific enhancer factor 2B
1tqe_R1e-22174173Myocyte-specific enhancer factor 2B
1tqe_S1e-22174173Myocyte-specific enhancer factor 2B
6byy_A1e-22174173MEF2 CHIMERA
6byy_B1e-22174173MEF2 CHIMERA
6byy_C1e-22174173MEF2 CHIMERA
6byy_D1e-22174173MEF2 CHIMERA
6c9l_A1e-22174173Myocyte-specific enhancer factor 2B
6c9l_B1e-22174173Myocyte-specific enhancer factor 2B
6c9l_C1e-22174173Myocyte-specific enhancer factor 2B
6c9l_D1e-22174173Myocyte-specific enhancer factor 2B
6c9l_E1e-22174173Myocyte-specific enhancer factor 2B
6c9l_F1e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0884s0020.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1445850.0EF144585.1 Populus trichocarpa clone WS01111_G09 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024438454.11e-164truncated transcription factor CAULIFLOWER A isoform X2
SwissprotQ6E6S71e-116AP1_VITVI; Agamous-like MADS-box protein AP1
TrEMBLA9P8W71e-163A9P8W7_POPTR; Uncharacterized protein
STRINGEOY221351e-128(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58832119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.15e-97AGAMOUS-like 8
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]