PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0811s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 281aa    MW: 30684.8 Da    PI: 6.6946
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0811s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.41.6e-4061051100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +Ca+Ck+lrrkC+++Cvlapyfp +qp+kfa+vhk+FG snv kll++lp  +r da++sl++eAe r+rdPvyG+vg+i+ l++++
  SapurV1A.0811s0010.1.p   6 PCASCKFLRRKCTQECVLAPYFPPDQPQKFAIVHKVFGQSNVAKLLNELPAAQRADAVNSLAFEAEERLRDPVYGCVGLISVLKNRV 92 
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             +ql+++l  +++e
  SapurV1A.0811s0010.1.p  93 DQLQSDLYIARNE 105
                             ******9998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.8415106IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-406102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MSSISPCASC KFLRRKCTQE CVLAPYFPPD QPQKFAIVHK VFGQSNVAKL LNELPAAQRA  60
DAVNSLAFEA EERLRDPVYG CVGLISVLKN RVDQLQSDLY IARNELAHYI GPQAVLPTVA  120
QPQHLADPPS AVINHNVMPM MGLSGGQMGI RAEAHQRHHA HPQQICKAQQ LAAMVAPGEQ  180
EVLMAYEQQQ QQEMARFTGG FELADSTVAT GFHQINPAAA SSISSSFALG NDENTFQIQP  240
QGEPHPNQLL LQPQGQQQPR HIHQHPKSEI DEGRIVGPSC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-45510910114LOB family transfactor Ramosa2.1
5ly0_B2e-45510910114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0811s0010.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039214.11e-126PREDICTED: LOB domain-containing protein 36 isoform X1
RefseqXP_011039215.11e-126PREDICTED: LOB domain-containing protein 36 isoform X1
SwissprotQ9FKZ31e-69LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A2K1ZNY21e-123A0A2K1ZNY2_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11460.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-69ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]