PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0795s0080.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TCP
Protein Properties Length: 369aa    MW: 41101.8 Da    PI: 7.4753
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0795s0080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP100.92.2e-3148178289
                     TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                              g+kdrhsk++T +g+RdRRvRls+ +a++++dLqd+LG+ ++sk ++WLl++ak+ i+el+ ++  + +++ +++    +s++  +
  SapurV1A.0795s0080.1.p  48 FGGKDRHSKVCTIRGLRDRRVRLSVATAIQLYDLQDRLGLNQPSKVVDWLLNEAKQDIDELPPLPVMPGNFSLNHQAMLGSSHELGA 134
                             689*************************************************************77777666444433333322222 PP

                     TCP  89 ...........................................k 89 
                                                                        +
  SapurV1A.0795s0080.1.p 135 sqsgkevfkmnssinwedpnvfprpnswnsdafwrakskevvmD 178
                             22222343333333344444444444444444444333333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036347.2E-3050192IPR005333Transcription factor, TCP
PROSITE profilePS5136929.89750108IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0031347Biological Processregulation of defense response
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:0009507Cellular Componentchloroplast
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MITSSKEVDC PPKKEDDTKD GKISKASSSS APWLRLKDPR IVRVSRAFGG KDRHSKVCTI  60
RGLRDRRVRL SVATAIQLYD LQDRLGLNQP SKVVDWLLNE AKQDIDELPP LPVMPGNFSL  120
NHQAMLGSSH ELGASQSGKE VFKMNSSINW EDPNVFPRPN SWNSDAFWRA KSKEVVMDQL  180
NEKEYWKKRN EEDTQDSNIE GNSTAQVSSS NFFHRASHSS LPSLMNNGMP YGSFFHLEPP  240
NFPLSHMGNH GFSTHTGDIH NLNAVPLSSA LSLSSGSQFF VCQPGTTQSY FPSHVTASME  300
NDPRQINHFQ VMTPSTQNLF PNSLTPSPYH TSQSMKPSQY FSATPSLLRS DQNSESPPDH  360
KVDPGFPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-1855109155Putative transcription factor PCF6
5zkt_B1e-1855109155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00326DAPTransfer from AT3G02150Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0795s0080.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024444582.10.0transcription factor TCP13
RefseqXP_024444583.10.0transcription factor TCP13
TrEMBLB9IK870.0B9IK87_POPTR; Uncharacterized protein
STRINGPOPTR_0017s13050.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.16e-49plastid transcription factor 1