PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0765s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TCP
Protein Properties Length: 201aa    MW: 21591.4 Da    PI: 10.1083
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0765s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP105.77.3e-3353120673
                     TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                             ++++++hTkv gR+RRvR++a++aar+F+L++eLG+ +d++tieWLl+ a+++i++ tgt+++++   
  SapurV1A.0765s0020.1.p  53 SQSKDRHTKVHGRGRRVRMPALTAARVFQLTRELGHRSDGETIEWLLRHAEASIIASTGTGTIPSIPI 120
                             6789********************************************************88888333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.6E-2854129IPR005333Transcription factor, TCP
PROSITE profilePS5136925.49255109IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MASETVLYNF SSTSNTQHQQ PKLNNNSVVP SATPPATGAS QSRMAHPRKS TNSQSKDRHT  60
KVHGRGRRVR MPALTAARVF QLTRELGHRS DGETIEWLLR HAEASIIAST GTGTIPSIPI  120
STTVGSTPIS SSTPPASCKV HPVNCIGPEM FSLLTAPSSR VDLDYRHMPF TALLLQPMAA  180
TVAVDAEEGR QQEVTGEHKM *
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0765s0020.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2092280.0AC209228.1 Populus trichocarpa clone POP075-L19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006373942.11e-120transcription factor PCF1
SwissprotO238756e-35PCF1_ORYSJ; Transcription factor PCF1
TrEMBLB9N7J51e-119B9N7J5_POPTR; Uncharacterized protein
STRINGPOPTR_0016s11350.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.11e-28TCP family protein