PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0755s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 535aa    MW: 58013.6 Da    PI: 8.3686
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0755s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.52.7e-24182224244
                     WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                              epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  SapurV1A.0755s0030.1.p 182 LEPGRCRRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 224
                             69***************************************97 PP

2QLQ54.24.3e-19132164234
                     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                             +FT+aQ+ +L++Q+++yKy++a++PvPp+Ll +
  SapurV1A.0755s0030.1.p 132 PFTNAQWKELERQAMIYKYIMASVPVPPQLLIP 164
                             8*****************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.3E-11131167IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.2E-13132164IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.459132167IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.596181225IPR014977WRC domain
PfamPF088792.4E-20183224IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MMTIDDGLSV SNKAAKERNT PTTSDAVDFG VKLHQPIDHL QSFPFSATMM FPHVNHHRPI  60
FGSGPTSPCD RNNSLMNYRG DRIYSAAAAA TSGGVVGARN LQPFDISETS ITTAASLFRS  120
PGGNMAASLG FPFTNAQWKE LERQAMIYKY IMASVPVPPQ LLIPPPKMGD GLNVRFSNGA  180
DLEPGRCRRT DGKKWRCSRD VAPDQKYCER HMHRGRPRSR KHVELNTDHN NKKSRHNPDI  240
CTEAPVTVAI SNPTINSSNS GSASHDQFVG SMPQPYIQTL DFVNKSSEKT AAFDANGAFG  300
STYKEPRSLG WMLKGEAGPI ATNDQQWLHL VQKEIGLATQ GPFNNASALN QNYQGESLNL  360
NSFGEFNARE DQQSNQYSLF LDEAPRSFID AWSNDANSRN TSSVSSDGKL PLSPLSLSME  420
SNRSIGDEMG QIQMGLRLIK PYKNQECGHN SSTPGGPLAE VLQLRTSNTM GANQSSSIIE  480
NGDSISPPAT TVSSPSGVLQ KKLASFSDSS GNSSPTHVSS RTKPGTAMLW LNQG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0755s0030.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024437935.10.0growth-regulating factor 4
TrEMBLA0A2K1Y7R00.0A0A2K1Y7R0_POPTR; Uncharacterized protein
STRINGPOPTR_0012s02950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.14e-33growth-regulating factor 7