PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0730s0060.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARR-B
Protein Properties Length: 686aa    MW: 75116.2 Da    PI: 6.3143
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0730s0060.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.72.6e-28197250155
                 G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                             kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  SapurV1A.0730s0060.1.p 197 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 250
                             79*******************.********************************8 PP

2Response_reg78.62.2e-26211291109
                             EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHH CS
            Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeed 85 
                             vl vdD+p+ + ll+++l++ +y +v++++++  al++l+e++  +D+++ D+ mp+mdG++ll+     e++lp+i+++a+g++++
  SapurV1A.0730s0060.1.p  21 VLAVDDDPTCLLLLETLLRRCQY-NVTTTSQAITALNMLRENKnnFDVVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDPKL 105
                             799********************.***************888888*******************87754.558************** PP

                             HHHHHHTTESEEEESS--HHHHHH CS
            Response_reg  86 alealkaGakdflsKpfdpeelvk 109
                             + + +  Ga d+l Kp+ +eel +
  SapurV1A.0730s0060.1.p 106 VMKGITHGACDYLLKPVRIEELKN 129
                             *********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.8E-1661678IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23004.8E-4218162No hitNo description
SuperFamilySSF521726.12E-3618143IPR011006CheY-like superfamily
SMARTSM004482.9E-3219131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.36520135IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.7E-2321129IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.02E-2322135No hitNo description
SuperFamilySSF466897.53E-20194254IPR009057Homeodomain-like
PROSITE profilePS5129412.269194253IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-30194255IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-25197250IPR006447Myb domain, plants
PfamPF002491.2E-6199249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    Send to blast
MTVEQGIVDS NIDQFPIGMR VLAVDDDPTC LLLLETLLRR CQYNVTTTSQ AITALNMLRE  60
NKNNFDVVIS DVHMPDMDGF KLLELVGLEM DLPVIMLSAN GDPKLVMKGI THGACDYLLK  120
PVRIEELKNI WQHVIRRKKC DNKDRNSSDN RDKPNQGSSE ATPDQKLNKK RKDQNEDEDE  180
DRDENENENE DPATQKKPRV VWSVELHRKF VAAVNQLGID KAVPKKILDL MNVEKLTREN  240
VASHLQKYRL YLKRISTVAN QQANMVAALG SSDASYLQMN SMSGLGLHNL AGSGQFHNTP  300
FRSLPSSGML SRLNSPAVLG IRGLPSPGVI RIGHVQSAPH SANGLSHFQT VGHPGNNGNI  360
LQGMPMSLEL DQIQSNKGVN YVRELPTHLD DTASFPISSG STDMKIIAGS SNSPFVGVSN  420
KPLMLEGHGQ GLQDGQKFGN QSSLAAGALD PGYSSHFPDH GRCNDNWSNA VQSNGVQSNS  480
FTLNDCFKQS TLHPSAIRDS MSAMALQSRN NHCDVSSIST LPIHLQDSKA DLQCQVAAVS  540
RDAGQIINNG PLGWDDHRQD DPYHANGISN SVNSAIPNGN GSLIGRSLDN MISQRPRSFS  600
STGQSNFIDT SLMKHNEVES SAMETLVRSK DGYLMGQQKP QDSYVSNNFG SLEDFVSVMV  660
KQEQDKVKLP EGDLGSCGYS LWTCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-26195256364ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0730s0060.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081440.0FN908144.1 Populus x canadensis mRNA for putative B-type response regulator 22 (rr22 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024459850.10.0two-component response regulator ARR12 isoform X1
SwissprotA2X1N21e-150ORR24_ORYSI; Two-component response regulator ORR24
TrEMBLA0A2K2A8M00.0A0A2K2A8M0_POPTR; Two-component response regulator
STRINGPOPTR_0006s27800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-131response regulator 12