PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0705s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARR-B
Protein Properties Length: 708aa    MW: 77723.3 Da    PI: 6.4023
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0705s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.61e-26192245155
                 G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                             kpr++W+ eLH++Fv av+ L G++kA+Pk+il+lm+ + Lt+e+v+SHLQkYRl
  SapurV1A.0705s0030.1.p 192 KPRVVWSVELHRKFVAAVNIL-GIDKAVPKKILDLMNAEKLTRENVASHLQKYRL 245
                             79*******************.********************************8 PP

2Response_reg77.74.2e-26211291109
                             EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHH CS
            Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeed 85 
                             vl vdD+p+ + ll+++l++ +y +v+++++++ al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g++++
  SapurV1A.0705s0030.1.p  21 VLAVDDDPTCLLLLETLLRRCQY-NVTTTSQATTALRMLRENKnkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDPKL 105
                             799********************.***************888888*******************87754.558************** PP

                             HHHHHHTTESEEEESS--HHHHHH CS
            Response_reg  86 alealkaGakdflsKpfdpeelvk 109
                             + + +  Ga  +l Kp+ +eel +
  SapurV1A.0705s0030.1.p 106 VMKGITHGACYYLLKPVRIEELKT 129
                             *********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23003.0E-4118158No hitNo description
SuperFamilySSF521722.42E-3518143IPR011006CheY-like superfamily
SMARTSM004485.3E-3219131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.21320135IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.1E-2321130IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.95E-2322135No hitNo description
PROSITE profilePS5129411.464189248IPR017930Myb domain
SuperFamilySSF466898.24E-19189249IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28189250IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23192245IPR006447Myb domain, plants
PfamPF002495.0E-6194244IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 708 aa     Download sequence    Send to blast
MTVEQGIGDS SIEKFPIGMR VLAVDDDPTC LLLLETLLRR CQYNVTTTSQ ATTALRMLRE  60
NKNKFDLVIS DVHMPDMDGF KLLELVGLEM DLPVIMLSAN GDPKLVMKGI THGACYYLLK  120
PVRIEELKTI WQHLIRRKKS DNKDRNSLDN RDKPDEGPDQ KLNKKRKDQN GDEDPDEDED  180
EHENEDPTTQ KKPRVVWSVE LHRKFVAAVN ILGIDKAVPK KILDLMNAEK LTRENVASHL  240
QKYRLYLKRI STVANQQANM VAALGSSDAS YLQINSMSRL GLHNLAGSAQ FHSTPFRSLP  300
SSGMLERLNS PPVLGIHGLP SPGVIQLGHV QTAPHYANGP SHFQTAGHPG NNGNLLQGMP  360
MPLELDQIQS NKGVNYIPEL PTHPGDTASF PVSSGSTDLK IIAGSSNSPF VDVSNKHLIL  420
EEHGQGLQDG QKFGKKSSLS AGSLNPRYSS NFPDHGRCND NWSNAVQSNG VQSNSLTLND  480
CFKRSILHPS AIRESMSTMA LQSRNNPCDV SSISTLPIHL QDSKADVPCQ VGVATVSSNA  540
GQLINNGPLG WDDHRQDDPY HSNGLSNSIN SAIPINGNGN PNGCNLDANS LFLQRTTSFS  600
STGLSNFVDT SLMKHNEVEC SAMETLVRSR DGYFPSQEKP QDGSVLNNFG SLEDLVSVMV  660
NQATNHSWLG DSLGECLSLC VLDNLGEYYF SRKDFSSLKT WRPLQSP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-25188251164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0705s0030.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081440.0FN908144.1 Populus x canadensis mRNA for putative B-type response regulator 22 (rr22 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024446133.10.0two-component response regulator ORR24 isoform X1
SwissprotA2X1N21e-140ORR24_ORYSI; Two-component response regulator ORR24
TrEMBLA0A2K1WUJ90.0A0A2K1WUJ9_POPTR; Two-component response regulator
STRINGPOPTR_0018s02330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-120response regulator 12