PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0697s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 406aa    MW: 45415.1 Da    PI: 7.5358
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0697s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.81e-391362351100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k++k+l++ e+++am+++++++++ra+dPv G++++i++lq+++
  SapurV1A.0697s0010.1.p 136 ACAACKYQRRKCAPDCILAPYFPHNRQRQFLNAHKLFGVSNISKIIKNLNPPEKDEAMRTIIFQSDVRANDPVGGCYRMIRDLQREI 222
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             e ++ael+ + ++
  SapurV1A.0697s0010.1.p 223 EYSRAELDFVLHQ 235
                             ******9988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.01135236IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-36136231IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MLDKFCIVGP TKIRGSTAVY KKHLFNASPP NANIYLRNID VGRIPCDFLL RQKGKYVVPD  60
DILLDDVHRS NSKEKRKGLK AAAERKKRGE KPFPNKKTAP APPATHPNSL IISKTTIANS  120
KNMSNISRTG NCTTQACAAC KYQRRKCAPD CILAPYFPHN RQRQFLNAHK LFGVSNISKI  180
IKNLNPPEKD EAMRTIIFQS DVRANDPVGG CYRMIRDLQR EIEYSRAELD FVLHQLAIYR  240
AQAAAQQQTQ LIQAQAAAAA AAAAAAPDQQ TDHDCQGIII TDTFDMYDPV MQYHDQYQQA  300
HQDHQEFVIH NPDNNQLHLQ DQDPANVWAT AATVQDISSL SISSSPNYLD DQVKQAYNGN  360
DQCSTQDDHS KPDVLDANNV NFEPDDQDQL VDMRFVPSTQ LLISS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2413723912114LOB family transfactor Ramosa2.1
5ly0_B1e-2413723912114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0697s0010.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2164670.0AC216467.1 Populus trichocarpa clone POP034-D10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385440.20.0LOB domain-containing protein 20
TrEMBLA0A2K2B1890.0A0A2K2B189_POPTR; Uncharacterized protein
STRINGPOPTR_0003s04520.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-56LOB domain-containing protein 22