PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0692s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GeBP
Protein Properties Length: 381aa    MW: 42636.8 Da    PI: 7.1571
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0692s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573118.63.4e-37160255298
                  DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqki 88 
                             lfqrlw+eeDei+lLqG+idf a++g +ps+d+++f++f+k+s++f+vs +ql +Ki rL+kKf+++vk  k+g++++fsk+hdqk 
  SapurV1A.0692s0040.1.p 160 LFQRLWTEEDEISLLQGIIDFIAEKGYEPSKDTNEFFDFIKQSLHFDVSMTQLKDKISRLRKKFENHVKG-KKGENKVFSKPHDQKG 245
                             79******************************************************************99.99************** PP

                  DUF573  89 felskkiWgs 98 
                             f+lsk iWgs
  SapurV1A.0692s0040.1.p 246 FDLSKYIWGS 255
                             ********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-32161254IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MAPKRAPPVR DPPSASSSEE EETSSGEEEA SDDERSQPSP PQPQTKTIRT QNSTPKKPEP  60
TTHQSESELE SESGSESGSE SEPGQSVKPL TSKPMEQIPP KEAAAAVVKK SRSKPAVAAT  120
PEKSTAVKRG NGADRDPKDL KRAKNKQSDP EKSEDSKKQL FQRLWTEEDE ISLLQGIIDF  180
IAEKGYEPSK DTNEFFDFIK QSLHFDVSMT QLKDKISRLR KKFENHVKGK KGENKVFSKP  240
HDQKGFDLSK YIWGSEGCIK ANGKKNTNLN DNKKGNSKKL EALKADLGID VGEEERMEVE  300
MERDSSVKKV LKFDRKASVG TMEDYVVRCG LDFAHGVKKE EMEEKWRKLH IAELELFLKR  360
NELLGEQGKI MLSAFKADKD *
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0692s0040.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1451180.0EF145118.1 Populus trichocarpa clone WS01120_J07 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313912.10.0GLABROUS1 enhancer-binding protein-like
TrEMBLB9HMZ50.0B9HMZ5_POPTR; GeBP family protein
STRINGPOPTR_0009s09150.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.17e-33DNA-binding storekeeper protein-related transcriptional regulator