PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0692s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GeBP
Protein Properties Length: 382aa    MW: 42885.2 Da    PI: 8.0611
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0692s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573108.74.2e-34162257298
                  DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqki 88 
                             lfqrlw+e+Dei+lLqG+idf +++g +p +d+ af++f+k+s +f+vs  ql +K+ rL+kKf ++vk  k+g++++fsk+hdqk 
  SapurV1A.0692s0010.1.p 162 LFQRLWTEDDEISLLQGIIDFIDEKGFDPLKDTYAFFDFIKQSFHFDVSMAQLKDKVFRLRKKFDNQVKG-KKGENKVFSKPHDQKG 247
                             79*****************************************************************999.99************** PP

                  DUF573  89 felskkiWgs 98 
                             f+lsk iWgs
  SapurV1A.0692s0010.1.p 248 FDLSKCIWGS 257
                             ********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.8E-30163256IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MAPKRAPRVK DPPSASSSEE EEISSGEEEA SDDERSQPSP PQPQTKTIRT RNSTPKKPEP  60
TTHQSESELE SESGSDSESE PEPEPGQSVK RIPSKPMEEI PPKEAAAAAV KKSRSKPAVA  120
ATPEKSTAVK RGNGADRDPK DLKRAKNKQS DPEKSDDSKK QLFQRLWTED DEISLLQGII  180
DFIDEKGFDP LKDTYAFFDF IKQSFHFDVS MAQLKDKVFR LRKKFDNQVK GKKGENKVFS  240
KPHDQKGFDL SKCIWGSEGC IKAIGKKNTN FNDNKKRNSK KLEALKADLG IDAGEERMEV  300
EMERNSSVKK VLKFDRKASV GTMEDYVARC GLDFAHGVKK EEMEEKWRKL HIAELELFLK  360
RNELLGEQGK IMLSALTADK D*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0692s0010.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1451180.0EF145118.1 Populus trichocarpa clone WS01120_J07 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313912.10.0GLABROUS1 enhancer-binding protein-like
TrEMBLB9HMZ50.0B9HMZ5_POPTR; GeBP family protein
STRINGPOPTR_0009s09150.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.19e-34DNA-binding storekeeper protein-related transcriptional regulator