PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0673s0190.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 165aa    MW: 18174.9 Da    PI: 7.3688
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0673s0190.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.85e-4561051100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+
  SapurV1A.0673s0190.1.p   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQV 92 
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             +ql+ +la++++ 
  SapurV1A.0673s0190.1.p  93 SQLQMQLAVAQAD 105
                             ********99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9365106IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPVHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVSQLQMQLA VAQADILCIQ MQHEPAMPSP  120
QMDPQDKSFL VQNSLPQYLN FGSSGNVIQY DSLKRESMFG DMIS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311246.21e-115hypothetical protein POPTR_0008s07280g
SwissprotQ8LBW38e-77LBD12_ARATH; LOB domain-containing protein 12
TrEMBLB9HHU91e-115B9HHU9_POPTR; Uncharacterized protein
STRINGPOPTR_0008s07280.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-78LBD family protein