PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0650s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 164aa    MW: 18089.7 Da    PI: 8.0431
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0650s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.47.5e-41111101100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaCk+l+r+C+++C++apyf +++pkkfa vhk+FGasnv+k+l+++pee+r+++++sl+yeAear+rdPvyG++g i  lq+++
  SapurV1A.0650s0120.1.p  11 SCAACKLLKRRCTPSCIFAPYFRSDEPKKFAKVHKVFGASNVSKILNEVPEEQRDETVNSLAYEAEARLRDPVYGCIGAIALLQRRM 97 
                             6************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                              +l+++la ++++
  SapurV1A.0650s0120.1.p  98 VELQVDLAIARAR 110
                             *******999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.55810111IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-4011108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MRNHEPRASS SCAACKLLKR RCTPSCIFAP YFRSDEPKKF AKVHKVFGAS NVSKILNEVP  60
EEQRDETVNS LAYEAEARLR DPVYGCIGAI ALLQRRMVEL QVDLAIARAR LARYSASSPP  120
ILNDHGSMIP TLAELPACGG FADCFSQNSS DTMNDLSQFP YIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4761156115LOB family transfactor Ramosa2.1
5ly0_B2e-4761156115LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0650s0120.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1448260.0EF144826.1 Populus trichocarpa clone WS01118_L02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011035904.13e-98PREDICTED: LOB domain-containing protein 21-like
RefseqXP_024465072.13e-98LOB domain-containing protein 21
SwissprotQ9SRL82e-64LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A2K1YWC27e-97A0A2K1YWC2_POPTR; Uncharacterized protein
STRINGPOPTR_0010s19340.18e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59443353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.16e-61LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]