PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0586s0110.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HD-ZIP
Protein Properties Length: 826aa    MW: 89446.5 Da    PI: 6.0837
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0586s0110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.48e-21118173156
                             TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  SapurV1A.0586s0110.1.p 118 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLCLETRQVKFWFQNRRTQMK 173
                             688999***********************************************999 PP

2START198.13.9e-623285521205
                             HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S. CS
                   START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla. 77 
                             ela++a++elvk+a+ +ep+W +s+    e+ n +e+ ++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++ 
  SapurV1A.0586s0110.1.p 328 ELALAAMDELVKMAQTDEPLWIRSYeggrEIMNHEEYSRTFTPCIGmkpsgFVSEASRETGMVIINSLALVETLMDSN-RWAEMFPc 413
                             5899************************99***********9988899******************************.******** PP

                             ...EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEE CS
                   START  78 ...kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgil 153
                                + +t++vi +g      g lqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +   +s+v +++lpSg++
  SapurV1A.0586s0110.1.p 414 viaRTSTTDVIANGmggtrnGSLQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGaPPSFVNCRRLPSGCV 500
                             *****************************************************************99999999************** PP

                             EEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                   START 154 iepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                             +++++ng+skvtw+eh+++++++ h+l+r+l++sg+ +ga++w atlqrq e
  SapurV1A.0586s0110.1.p 501 VQDMPNGYSKVTWIEHAEYDESQTHQLYRPLISSGMGFGAQRWIATLQRQSE 552
                             *************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.07E-20101175IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-21105175IPR009057Homeodomain-like
PROSITE profilePS5007117.216115175IPR001356Homeobox domain
SMARTSM003891.7E-17116179IPR001356Homeobox domain
CDDcd000862.05E-18117175No hitNo description
PfamPF000462.2E-18118173IPR001356Homeobox domain
PROSITE patternPS000270150173IPR017970Homeobox, conserved site
PROSITE profilePS5084843.838319556IPR002913START domain
SuperFamilySSF559611.33E-34321553No hitNo description
CDDcd088756.40E-123323552No hitNo description
SMARTSM002342.3E-46328553IPR002913START domain
PfamPF018528.0E-54328552IPR002913START domain
SuperFamilySSF559612.75E-23581751No hitNo description
SuperFamilySSF559612.75E-23778818No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 826 aa     Download sequence    Send to blast
MSFGGFLDNT SPGGGGARIV ADIPFNNNSM PTGGAIIAHP RLLSPSITKP MFNSPGLSLA  60
LQQPNIDGQG DITRMSENFE TSVGRRSREE EHESRSGSDN MDGASGDDQD AADNPPRKKR  120
YHRHTPQQIQ ELEALFKECP HPDEKQRLEL SRRLCLETRQ VKFWFQNRRT QMKTQLERHE  180
NSLLRQENDK LRAENMSIRD TMRNPMCSNC GGPAIIGDIS LEEQHLRIEN ARLKDELDRV  240
CALAGKFLGR PISSLASSLG PPMPNSSLEL GVGSNGFAGL STVAATLPLG PDFVGGISGA  300
LPLLTQARPA TTGVTGIGRS LERSMFLELA LAAMDELVKM AQTDEPLWIR SYEGGREIMN  360
HEEYSRTFTP CIGMKPSGFV SEASRETGMV IINSLALVET LMDSNRWAEM FPCVIARTST  420
TDVIANGMGG TRNGSLQLMH AELQVLSPLV PVREVNFLRF CKQHAEGVWA VVDVSIDTIR  480
ETSGAPPSFV NCRRLPSGCV VQDMPNGYSK VTWIEHAEYD ESQTHQLYRP LISSGMGFGA  540
QRWIATLQRQ SECLAILMSS NVPSRDHTAI TASGRRSMLK LAQRMTDNFC AGVCASTVHK  600
WNKLNAGNVD EDVRVMTRKS VDDPGEPPGI VLSAATSVWL PVSPQRLFDF LRDERLRSEW  660
DILSNGGPMQ EMAHIAKGQD HGNCVSLLRA SAMNANQSSM LILQETCIDA AGSLVVYAPV  720
DIPAMHVVMN GGDSAYVALL PSGFAIVPDG PGSLGAPAAN GGPTANNNGN GGGPERVSGS  780
LLTVAFQILV NSLPTAKLTV ESVETVNNLI SCTVQKIKAA LQCES*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0586s0110.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320755.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLB9IC550.0B9IC55_POPTR; Uncharacterized protein
STRINGPOPTR_0014s07130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]