PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0578s0120.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 182aa    MW: 21051.3 Da    PI: 10.3828
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0578s0120.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.94.8e-32958150
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                            krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  SapurV1A.0578s0120.5.p  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
                            79**********************************************95 PP

2K-box92.95.5e-3179168898
                   K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                             + +e++++s++qe++kLk+++e+Lqr+qRhllGedL++L++keLq+Le+qLe +l   R++K ++l+eq+e+l+kke+ l + n+ L
  SapurV1A.0578s0120.5.p  79 NSSERETQSWYQEATKLKAKYESLQRTQRHLLGEDLGPLNVKELQNLEKQLEGALALARQRK-QVLTEQMEDLRKKERHLGDLNRHL 164
                             368999*****************************************************998.8*********************** PP

                   K-box  95 rkkl 98 
                             + k+
  SapurV1A.0578s0120.5.p 165 KLKV 168
                             9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.655161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.19E-34288IPR002100Transcription factor, MADS-box
CDDcd002658.44E-44272No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-33323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-333859IPR002100Transcription factor, MADS-box
PfamPF014862.5E-2680168IPR002487Transcription factor, K-box
PROSITE profilePS5129714.28985175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0009911Biological Processpositive regulation of flower development
GO:0010094Biological Processspecification of carpel identity
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSA  60
SVTKTLERYQ RCCYTPQENS SERETQSWYQ EATKLKAKYE SLQRTQRHLL GEDLGPLNVK  120
ELQNLEKQLE GALALARQRK QVLTEQMEDL RKKERHLGDL NRHLKLKVLP QQLPALVQKI  180
G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-22169169MEF2C
5f28_B3e-22169169MEF2C
5f28_C3e-22169169MEF2C
5f28_D3e-22169169MEF2C
6byy_A3e-22169169MEF2 CHIMERA
6byy_B3e-22169169MEF2 CHIMERA
6byy_C3e-22169169MEF2 CHIMERA
6byy_D3e-22169169MEF2 CHIMERA
6bz1_A4e-22169169MEF2 CHIMERA
6bz1_B4e-22169169MEF2 CHIMERA
6bz1_C4e-22169169MEF2 CHIMERA
6bz1_D4e-22169169MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0578s0120.5.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011034912.11e-115PREDICTED: MADS-box transcription factor 6 isoform X2
RefseqXP_024440764.11e-115MADS-box transcription factor 6 isoform X2
SwissprotQ8LLR11e-102MADS3_VITVI; Agamous-like MADS-box protein MADS3
TrEMBLA0A2K1XRU71e-113A0A2K1XRU7_POPTR; Uncharacterized protein
STRINGEOX961401e-106(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.14e-84AGAMOUS-like 6
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]