PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0572s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family bZIP
Protein Properties Length: 208aa    MW: 23554.5 Da    PI: 9.5065
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0572s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.63.1e-14106166363
                             XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                  bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              +k+ rr+++NRe+ArrsR R+k++ie L+ +v +L++ N++L +++ +l +   +  +e+
  SapurV1A.0572s0020.1.p 106 NDKKLRRMISNRESARRSRMRRKKQIEDLQYRVNQLQNMNHQLSEKVIHLLESNHQTLQEN 166
                             79********************************************999988888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.2E-14104168IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.737106155IPR004827Basic-leucine zipper domain
PfamPF001701.8E-12107166IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.13E-11108159No hitNo description
Gene3DG3DSA:1.20.5.1706.2E-12108164No hitNo description
CDDcd147028.73E-16109160No hitNo description
PROSITE patternPS000360111126IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MEPHSKIKKF HGLPHANSVH NLFTIPKPTQ KQYPSATSQP IVESTNYSSP LANISENPES  60
SSSLLDKFLT NSQFHVPLHI LSPNTSSLST DSTVAEPRDE QLGICNDKKL RRMISNRESA  120
RRSRMRRKKQ IEDLQYRVNQ LQNMNHQLSE KVIHLLESNH QTLQENSQIK EKVSSLQVVL  180
SDLLTPLRNV DEGDCNSIHL KGETSNR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0572s0020.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011010367.11e-124PREDICTED: basic leucine zipper 10-like
TrEMBLA0A2K1XI231e-122A0A2K1XI23_POPTR; Uncharacterized protein
STRINGPOPTR_0015s03580.12e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.12e-22basic leucine-zipper 70