PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0569s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GATA
Protein Properties Length: 373aa    MW: 41112.9 Da    PI: 5.7338
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0569s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.71.8e-19288322135
                    GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                             Cs+Cg+ kTp+WR gp+g+ktLCnaCG++y++ +l
  SapurV1A.0569s0120.1.p 288 CSHCGVQKTPQWRAGPNGSKTLCNACGVRYKSGRL 322
                             *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.4E-16282336IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.598282318IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.04E-14284345No hitNo description
Gene3DG3DSA:3.30.50.102.8E-15286320IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.95E-15287335No hitNo description
PfamPF003202.4E-17288322IPR000679Zinc finger, GATA-type
PROSITE patternPS003440288313IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MLYQTHLFSS PKSTALSLLS FSYPLRFRFE KQEMEYVEGA LKTSFGKEMA VKFSPQVFDD  60
FWAVNVPNGM SSDDFSVDKL LDFSNENDFI EEEEEEGDKE KPCVFSASAS PKQEALDEDK  120
SSDSSPSFAV KDDFFSVPTS ELCVPTDDFA SLEWLSHFVE DSNSEYAAPF PASISPPEPH  180
KENPDEQEKV VLEEPCFKTP VPGKARSKRT RNGVRVWPLG SPSLTESSSS SSSISSSSPS  240
NPWLIYSKPG SKVEPVWFEK PVAKKMKRNP ADEAAASGGG GTSSSRRCSH CGVQKTPQWR  300
AGPNGSKTLC NACGVRYKSG RLLPEYRPAC SPTFSKEVHS NHHRKVLEMR RKKEGPVPTE  360
PGLVQPFVPS LG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310287.20.0hypothetical protein POPTR_0007s13700g
SwissprotQ9FH571e-84GATA5_ARATH; GATA transcription factor 5
TrEMBLB9HFC80.0B9HFC8_POPTR; Uncharacterized protein
STRINGPOPTR_0007s13700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.28e-76GATA transcription factor 5