PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0554s0130.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SBP
Protein Properties Length: 1073aa    MW: 119008 Da    PI: 7.9565
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0554s0130.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.64.9e-40144221178
                             --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                     SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                             +Cqv++C+++l++ak+yhrrhkvCevhska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+q+
  SapurV1A.0554s0130.1.p 144 RCQVDNCKENLTNAKDYHRRHKVCEVHSKATKTLVGKQMQRFCQQCSRFHPLTEFDEGKRSCRRRLAGHNRRRRKTQP 221
                             6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.0E-33139206IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.821142219IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.19E-36143223IPR004333Transcription factor, SBP-box
PfamPF031102.5E-29145218IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1073 aa     Download sequence    Send to blast
MEEVGAQVAA PMFIHQALST RYCDLTSMAK KRDLSYQMPN FQLQQHHFLE TSLGKNWNSK  60
AWDWDSVGFV ARPSDAAETS RLGTASREAK KKDESDYKTK SISASEDDGL GLNLGGSLTC  120
VEEPVSRPNK RVRSGSPANG SYPRCQVDNC KENLTNAKDY HRRHKVCEVH SKATKTLVGK  180
QMQRFCQQCS RFHPLTEFDE GKRSCRRRLA GHNRRRRKTQ PEDVTSRLAV PGNQDTNINA  240
NMDIVNLLTA LTRYQGRTED KSTNCTTVPD KDQLIQILSK INSLPLPVDL SAKLSNIASL  300
DGKSPDQPSS ACQNRLHGTA SSSSTMDLLA VLSTTLAASA PDALAILSQR SSQSSDSDRS  360
KFTSPNHVTG SNLQKRSNVE FPSMGGERVS YCHESPVEDS DCQIQESRHN FPLQLFSSSP  420
ENDSPPKLAS SRKYFSSDSS NPIEDRSPSS SPPVVQKFFP LKSTAETMKS EKMSISREVN  480
ANVEGSRSHA CVLPLELFRG SNREPDHGSF QSFPYQGGYT SSSGSDHSPT SQNSDSQDRT  540
GRIIFKLFDK DPSHFPGTLR TQIYNWLSNS PSEMESYIRP GCVVLSVYLS MSSAAWELFE  600
RNLLQQVDSL VQDSDSDFWR SGRFLLNTGR QLASYKDGKI RLCKSWKTWS SPELMSVSPV  660
AVVGGQETSL QLKGRNLTSP GTRIHCTYMG GYTSKEITGS TSPGSLYDEI NVGGFRIHGP  720
SPGILGRCFI EVENGFKVNS FPVIIADAPI CKELRLLESE FDEKAEVGDI VSQEQAHDLG  780
QPRSKEEVLH FLNELGWLFQ RKREASMIDV PDFSLSRFKF LLIFSVERDY CVLVKTILGM  840
LVERNMCRDE LSKEALEMLS EVQLLNRSVK RSCRKMVDLL IHYSIVTHDN FSRTYIFPPN  900
VRGAGGITPL HLVACASGSD GLVDALTNDP QEIGLSCWYS LLDANGQSPN AYAAMTKNHS  960
YNLLVARKLA DKINGQVSVT IGNEIEQPVV EQECREISQF QQRRKSCAKC AIVAAKFHKR  1020
VPGSQGLLQR PYIHSMLAIA AVCVCVCLFL RGAPDIGAVA PFKWENLDFG TI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-29135218184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0554s0130.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3842951e-38FQ384295.1 Vitis vinifera clone SS0AAG20YM14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024456224.10.0squamosa promoter-binding-like protein 14
RefseqXP_024456225.10.0squamosa promoter-binding-like protein 14
RefseqXP_024456226.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2K2AMS40.0A0A2K2AMS4_POPTR; Uncharacterized protein
STRINGPOPTR_0005s28010.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]