PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0541s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Trihelix
Protein Properties Length: 284aa    MW: 34100.7 Da    PI: 9.1454
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0541s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.12.6e-2442124186
                trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                             +W+ qe+++ + +r e++ ++ ++k++k lWe +s+km+e+g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  SapurV1A.0541s0070.1.p  42 QWSIQETKEFLMIRAELDPTFMEKKRNKVLWEVISNKMKEKGYNRSAEQCKCKWKNLFTRYKGCETIEPEA---MRQQFPFYNELQ 124
                             7********************************************************************95...55689****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.007339101IPR001005SANT/Myb domain
CDDcd122031.80E-2241106No hitNo description
PfamPF138373.4E-2042125No hitNo description
PROSITE profilePS500907.3294399IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEGNLHHQHH HQHQLQQYQL QQQQQQQQHI SVNVEASDKF PQWSIQETKE FLMIRAELDP  60
TFMEKKRNKV LWEVISNKMK EKGYNRSAEQ CKCKWKNLFT RYKGCETIEP EAMRQQFPFY  120
NELQTIFTSR MQRMLRAEAE EAAATGLKKK AVKLSSDDED ENEEIIEGEK GGIRKKLKKG  180
KTTGGTSGSG SINSLKECLE DFTKQQMQME MQWREVFEAR ENERMMREME WRRTMNKLEN  240
DRIVMERRWR EREEQRRVRE EARAERRDAL ITALLNKLRR EEI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322985.11e-144hypothetical protein POPTR_0016s12470g
SwissprotQ9SDW05e-70TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLB9IGA41e-144B9IGA4_POPTR; Uncharacterized protein
STRINGPOPTR_0016s12470.11e-144(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.11e-50Trihelix family protein