PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0505s0170.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HD-ZIP
Protein Properties Length: 340aa    MW: 37419.2 Da    PI: 10.0919
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0505s0170.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.11.3e-17170224256
                             T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  SapurV1A.0505s0170.1.p 170 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 224
                             778899***********************************************98 PP

2HD-ZIP_I/II126.21.4e-40170259191
             HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeL 87 
                             +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+ke  eL
  SapurV1A.0505s0170.1.p 170 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTKENRRLQKELLEL 256
                             69************************************************************************************* PP

             HD-ZIP_I/II  88 reel 91 
                             r +l
  SapurV1A.0505s0170.1.p 257 R-AL 259
                             9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.4E-18162227IPR009057Homeodomain-like
PROSITE profilePS5007116.86166226IPR001356Homeobox domain
SMARTSM003895.4E-15168230IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.9E-17170224IPR009057Homeodomain-like
PfamPF000464.3E-15170224IPR001356Homeobox domain
CDDcd000861.71E-15170227No hitNo description
PROSITE patternPS000270201224IPR017970Homeobox, conserved site
SMARTSM003407.1E-23226269IPR003106Leucine zipper, homeobox-associated
PfamPF021832.7E-10226260IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MELALSLGDA SKPFKFLDKT PKLSSKDLGF CMGLGSGFTA PARSHDKLGS HENNRQEDDQ  60
RRVSSDPPLQ LVLLPFSPVP LRHQPPSKIR FPWLTDNLVS EPGSAEGPGR GFDVNRSSMD  120
DADEGAALSS PNSAASSFQV DFGIRSGGGN KRDLEASRAT SDDEDNGLTR KKLRLSKEQS  180
AFLEESFKEH NTLNPKQKLA LAKQLNLRPR QVEVWFQNRR ARTKLKQTEV DCEYLKRCCE  240
TLTKENRRLQ KELLELRALK TSQPFYKQLP ATTLTMCPSC ERVATTTTSS SGTTTATTNP  300
SIRTTASKTL SLSAKPRLFP LSHGQAHQAA SLLTTTSKN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1168174TRKKLRL
2218226RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0505s0170.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM2629441e-101AM262944.1 Phillyrea latifolia partial mRNA for type II homeodomain-leucine zipper protein precursor (ophh-61B gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024459020.10.0homeobox-leucine zipper protein HAT14
SwissprotP466653e-98HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2K2A4R10.0A0A2K2A4R1_POPTR; Uncharacterized protein
STRINGPOPTR_0006s20820.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-79homeobox from Arabidopsis thaliana