PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0500s0280.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family VOZ
Protein Properties Length: 445aa    MW: 49107.9 Da    PI: 5.0386
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0500s0280.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4481.1e-1371884041217
                     VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatak 87 
                             pppsaf+gpkcalwdctrpaqg+ew++dycssfhatlalneg+pg++pvlrp+gi+lkd+llf+al+ak+qgk+vgip+cegaa +k
  SapurV1A.0500s0280.2.p 188 PPPSAFMGPKCALWDCTRPAQGAEWCEDYCSSFHATLALNEGPPGMSPVLRPRGINLKDNLLFDALTAKMQGKNVGIPQCEGAAVMK 274
                             89************************************************************************************* PP

                     VOZ  88 spwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyei 174
                             spwnaaelfdlsllegetirewlffdkprraf+sgnrkqrslpdysgrgwhesrkqvmke+gg+k+syymdpqp++++ewhlyeyei
  SapurV1A.0500s0280.2.p 275 SPWNAAELFDLSLLEGETIREWLFFDKPRRAFDSGNRKQRSLPDYSGRGWHESRKQVMKELGGKKKSYYMDPQPPGCHEWHLYEYEI 361
                             *************************************************************************************** PP

                     VOZ 175 neldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                             n++da+alyrlelkl+ +kk++kgkvskdsl+dlqkk+grlta
  SapurV1A.0500s0280.2.p 362 NNCDACALYRLELKLAGGKKTPKGKVSKDSLVDLQKKMGRLTA 404
                             *****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MQRGGKSKCA STSHHLLMDN AKSRLNDLQE RFFNIQAARE EGRNNDVALL EEQDISLGSF  60
SEDIGRLLQL CEEEDDATSP LTMQTVLKLE TQPEPNFQNL NLGNLTTFQD EYLVNSHSQE  120
VGFQGFHQHN SSSGLQSVAV SGPDITTLLD CHQFTLDEEF DPGLFVGTND TKECGINAES  180
NNLQYISPPP SAFMGPKCAL WDCTRPAQGA EWCEDYCSSF HATLALNEGP PGMSPVLRPR  240
GINLKDNLLF DALTAKMQGK NVGIPQCEGA AVMKSPWNAA ELFDLSLLEG ETIREWLFFD  300
KPRRAFDSGN RKQRSLPDYS GRGWHESRKQ VMKELGGKKK SYYMDPQPPG CHEWHLYEYE  360
INNCDACALY RLELKLAGGK KTPKGKVSKD SLVDLQKKMG RLTAVVTADN SPSDKGKTNA  420
DTEVGSVDFG SAQDQKTSGT GHGP*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0500s0280.2.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2131560.0AC213156.1 Populus trichocarpa clone POP076-I18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002326034.10.0transcription factor VOZ1
RefseqXP_024447611.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-161VOZ1_ARATH; Transcription factor VOZ1
TrEMBLB9IQS10.0B9IQS1_POPTR; VOZ family protein
STRINGPOPTR_0019s12260.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-163vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]