PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0474s0220.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 231aa    MW: 26068.6 Da    PI: 8.366
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0474s0220.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.24.2e-3616113198
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             aCa+Ck++r++C +dCvlapyfpae++++f++vhk+FG+snv+kl+k++++e+++++++slv+eA +r +dPv G++g +++lq++ 
  SapurV1A.0474s0220.1.p  16 ACASCKHQRKRCGEDCVLAPYFPAERMQEFQAVHKVFGVSNVIKLVKDVKKERQKETAESLVWEATCRRNDPVLGCYGKFKRLQEEF 102
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallk 98 
                             e  k +  ll+
  SapurV1A.0474s0220.1.p 103 ELYKMQQPLLN 113
                             99998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.49915116IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-3516109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MHRGGDMNNR VAMHQACASC KHQRKRCGED CVLAPYFPAE RMQEFQAVHK VFGVSNVIKL  60
VKDVKKERQK ETAESLVWEA TCRRNDPVLG CYGKFKRLQE EFELYKMQQP LLNQNMLRQQ  120
QQQRVVGAVY SKQPPLVLAW NGAGGIGNRV MDGGGGGYGG HDSSDLIADS IPHNIYPWQY  180
VQGHERSNQD ASSLLLPIQP SPPPPLHPFS VNGFDHQQYY HPELVRYAPE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-211711812113LOB family transfactor Ramosa2.1
5ly0_B1e-211711812113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0474s0220.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2131562e-89AC213156.1 Populus trichocarpa clone POP076-I18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024438951.13e-98LOB domain-containing protein 2
TrEMBLA0A3N7FWJ17e-97A0A3N7FWJ1_POPTR; Uncharacterized protein
STRINGPOPTR_0013s12770.14e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127222534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.11e-39LOB domain-containing protein 2