PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0474s0170.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family VOZ
Protein Properties Length: 470aa    MW: 52645 Da    PI: 5.0709
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0474s0170.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4381.2e-1342114271217
                     VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatak 87 
                             p psaf+gpkcalwdctrpaq +ewl+dycssfhatlalneg+pg+tpvlrp+gidlkd+llf++l ak+qgk+vgip+cegaa +k
  SapurV1A.0474s0170.2.p 211 PLPSAFMGPKCALWDCTRPAQVAEWLEDYCSSFHATLALNEGPPGMTPVLRPRGIDLKDNLLFETLIAKMQGKNVGIPQCEGAAVMK 297
                             78************************************************************************************* PP

                     VOZ  88 spwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyei 174
                             spwna+elfdlsllegetirewlffdkprraf+sgnrkqrslpdy+grgwhesrkqvmke+gg+k+syymdpqp++++ewhl+eyei
  SapurV1A.0474s0170.2.p 298 SPWNATELFDLSLLEGETIREWLFFDKPRRAFDSGNRKQRSLPDYNGRGWHESRKQVMKELGGQKKSYYMDPQPPGCHEWHLFEYEI 384
                             *************************************************************************************** PP

                     VOZ 175 neldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                             n++d +alyrlelkl+++kks+kgkvskd+ladlqkk+grlta
  SapurV1A.0474s0170.2.p 385 NNCDVCALYRLELKLTNGKKSPKGKVSKDPLADLQKKMGRLTA 427
                             *****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MQKGKKSKCT TMSHHQLMDN TKNRLNDLHE RFSNLQAARK EGRNSDVAVL EEQVYQSLHE  60
WKAELHVPSP ANSLLDTSLG SFSNDIGRML QLCEEEDDAM SPFTIQSVLK PEMQPEPNFQ  120
NLDLGNLTTF EDEYLVNSHS QGLGFQGFHQ PNSSPSGLQN VAVSALDITT LLDCQQFTLD  180
EEFDPGIFVG TNDTEECDKN TESYNLQYIS PLPSAFMGPK CALWDCTRPA QVAEWLEDYC  240
SSFHATLALN EGPPGMTPVL RPRGIDLKDN LLFETLIAKM QGKNVGIPQC EGAAVMKSPW  300
NATELFDLSL LEGETIREWL FFDKPRRAFD SGNRKQRSLP DYNGRGWHES RKQVMKELGG  360
QKKSYYMDPQ PPGCHEWHLF EYEINNCDVC ALYRLELKLT NGKKSPKGKV SKDPLADLQK  420
KMGRLTAVVT TDNSPPLKGK TRADRETDSG EVNFSHDQKT SDTGTGPGP*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0474s0170.2.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2131560.0AC213156.1 Populus trichocarpa clone POP076-I18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024438833.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-163VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2K1Y4Q30.0A0A2K1Y4Q3_POPTR; Uncharacterized protein
STRINGPOPTR_0013s12690.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-166vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]