PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0463s0130.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 221aa    MW: 25224.9 Da    PI: 7.8836
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0463s0130.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.11.8e-26959151
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            k+i+n++ rqvtfskRr g++KKA ELS+LCdae+a+++fs tgk++e+s+
  SapurV1A.0463s0130.1.p  9 KKIDNTTARQVTFSKRRRGLFKKACELSILCDAEIALMVFSATGKFFEFSN 59
                            68***********************************************95 PP

2K-box47.48.1e-17861711499
                   K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                              ++ +  +a L+kei +  re+R+  GedL++Ls++eLq+Le+ +e sl ++ + K + ++++i+ l  ke++l een++L++k++
  SapurV1A.0463s0130.1.p  86 LQHDSAVHAMLNKEIAEKTRELRQTRGEDLQELSMEELQKLEKIIEGSLCRVMEMKGDKIRMEINALESKEEQLMEENQRLKQKIM 171
                             67778888999******9******************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.352161IPR002100Transcription factor, MADS-box
SMARTSM004324.7E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-28273IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-26323IPR002100Transcription factor, MADS-box
CDDcd002658.76E-37368No hitNo description
PfamPF003197.5E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.52586176IPR002487Transcription factor, K-box
PfamPF014861.8E-1393170IPR002487Transcription factor, K-box
Gene3DG3DSA:1.20.5.1702.8E-4143175No hitNo description
PROSITE profilePS500588.654152212IPR015898G-protein gamma-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007186Biological ProcessG-protein coupled receptor signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005834Cellular Componentheterotrimeric G-protein complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004871Molecular Functionsignal transducer activity
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MTRRKIQIKK IDNTTARQVT FSKRRRGLFK KACELSILCD AEIALMVFSA TGKFFEFSNS  60
SIGQVIERRN LHPKNLDTYS QPPVELQHDS AVHAMLNKEI AEKTRELRQT RGEDLQELSM  120
EELQKLEKII EGSLCRVMEM KGDKIRMEIN ALESKEEQLM EENQRLKQKI MNLSKGQGHL  180
LEQGQSSDSM VTNISSNSAN PRQDCDNFCS FLTLGLPFPD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-17199192MEF2C
5f28_B2e-17199192MEF2C
5f28_C2e-17199192MEF2C
5f28_D2e-17199192MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0463s0130.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1447390.0EF144739.1 Populus trichocarpa clone WS01117_K02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006373017.21e-139MADS-box protein JOINTLESS
SwissprotQ9FUY64e-70JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLA0A2K1X3681e-138A0A2K1X368_POPTR; Uncharacterized protein
STRINGcassava4.1_015454m1e-84(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89033106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.13e-71MIKC_MADS family protein
Publications ? help Back to Top
  1. Nakano T,Kato H,Shima Y,Ito Y
    Apple SVP Family MADS-Box Proteins and the Tomato Pedicel Abscission Zone Regulator JOINTLESS have Similar Molecular Activities.
    Plant Cell Physiol., 2015. 56(6): p. 1097-106
    [PMID:25746985]