PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0400s0280.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 233aa    MW: 27031.8 Da    PI: 9.3674
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0400s0280.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.77.3e-29958150
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                            +rienk+ rqvtfskRrng+lKKA+ELS LCdaeva+iifss+gkl+e+ 
  SapurV1A.0400s0280.2.p  9 ERIENKISRQVTFSKRRNGLLKKAYELSLLCDAEVALIIFSSHGKLFEFG 58
                            69**********************************************95 PP

2K-box93.63.2e-31771725100
                   K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                             ++++  e+ +++l+qe+++L+++ e Lqr+qR++lGedL++L +keL+++e+qL+k l++ R++K++l+++ +eel+kke+el+een
  SapurV1A.0400s0280.2.p  77 QDTNILEEGSQTLYQEVSRLRAKCEALQRSQRNFLGEDLQPLAFKELEKIEKQLDKTLSQARQRKTQLMFDRMEELRKKEQELEEEN 163
                             5566778889***************************************************************************** PP

                   K-box  92 kaLrkklee 100
                             ++L++klee
  SapurV1A.0400s0280.2.p 164 RQLKTKLEE 172
                             ******987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.104161IPR002100Transcription factor, MADS-box
CDDcd002651.68E-40272No hitNo description
SuperFamilySSF554551.44E-31283IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-30323IPR002100Transcription factor, MADS-box
PfamPF003192.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-303859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129715.92986176IPR002487Transcription factor, K-box
PfamPF014867.9E-2786170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MGRGKVVLER IENKISRQVT FSKRRNGLLK KAYELSLLCD AEVALIIFSS HGKLFEFGSV  60
DINNTLQRYR QCCFNTQDTN ILEEGSQTLY QEVSRLRAKC EALQRSQRNF LGEDLQPLAF  120
KELEKIEKQL DKTLSQARQR KTQLMFDRME ELRKKEQELE EENRQLKTKL EEVLRLPVLQ  180
GAGDPSKADG NKHSQSQPAL QMGYHQYVYQ EQAFDARTIF PGKSNPIPRW FS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-21171171MEF2C
5f28_B4e-21171171MEF2C
5f28_C4e-21171171MEF2C
5f28_D4e-21171171MEF2C
6byy_A3e-21169169MEF2 CHIMERA
6byy_B3e-21169169MEF2 CHIMERA
6byy_C3e-21169169MEF2 CHIMERA
6byy_D3e-21169169MEF2 CHIMERA
6bz1_A3e-21169169MEF2 CHIMERA
6bz1_B3e-21169169MEF2 CHIMERA
6bz1_C3e-21169169MEF2 CHIMERA
6bz1_D3e-21169169MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0400s0280.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006377087.11e-147truncated transcription factor CAULIFLOWER A isoform X1
SwissprotQ8LLR14e-84MADS3_VITVI; Agamous-like MADS-box protein MADS3
TrEMBLU5FXL41e-146U5FXL4_POPTR; Uncharacterized protein
STRINGEOY230334e-86(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.16e-62AGAMOUS-like 6
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]