PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0400s0250.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 210aa    MW: 23960.5 Da    PI: 8.7114
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0400s0250.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.71.3e-27955147
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                            krien + rqvtfskR+ng+lKKA+ELS+LCdaevaviifs++g+l+
  SapurV1A.0400s0250.1.p  9 KRIENATSRQVTFSKRKNGLLKKAYELSILCDAEVAVIIFSQKGTLF 55
                            79******************************************996 PP

2K-box721.8e-2481170998
                   K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                               e+  e+l++e+a++ k+ie L++ qR+llG+dL+s+s keL+ + +qLe sl++iR++K++l+ eqie+lq+ke  l  en +L+
  SapurV1A.0400s0250.1.p  81 DVEQYKEQLRHESANMAKKIEILETLQRKLLGQDLDSCSPKELKDIGNQLEISLSNIRARKTQLFEEQIEQLQEKETLLLMENARLS 167
                             45677889******************************************************************************9 PP

                   K-box  96 kkl 98 
                             k+ 
  SapurV1A.0400s0250.1.p 168 KQC 170
                             985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.553161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-36160IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002651.47E-34371No hitNo description
PRINTSPR004045.8E-28323IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.63E-27373IPR002100Transcription factor, MADS-box
PfamPF003193.3E-251055IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2385170IPR002487Transcription factor, K-box
PROSITE profilePS5129714.99386176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MVRGKVQLKR IENATSRQVT FSKRKNGLLK KAYELSILCD AEVAVIIFSQ KGTLFASADQ  60
IQKTIDRYRE NAKQVHTDRI DVEQYKEQLR HESANMAKKI EILETLQRKL LGQDLDSCSP  120
KELKDIGNQL EISLSNIRAR KTQLFEEQIE QLQEKETLLL MENARLSKQC GAQPLQQSNQ  180
VVSYLSSCSK NSDIVETDLY IGLPQMRCL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A4e-171109191MEF2 CHIMERA
6byy_B4e-171109191MEF2 CHIMERA
6byy_C4e-171109191MEF2 CHIMERA
6byy_D4e-171109191MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0400s0250.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318261.11e-131MADS-box protein AGL42
RefseqXP_024437836.11e-131MADS-box protein AGL42
SwissprotQ9FIS11e-63AGL42_ARATH; MADS-box protein AGL42
TrEMBLB9I4G51e-130B9I4G5_POPTR; Uncharacterized protein
STRINGXP_004308127.14e-81(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66630102
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.32e-55AGAMOUS-like 42