PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0400s0200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 155aa    MW: 17270.6 Da    PI: 7.4216
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0400s0200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.34.1e-4151041100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaCk+lrr+C++dC+++pyfp++ p++fa+vh+++Gasnv k+l++lp + r +a++sl+yeA+ r++dPvyG+vgvi+ l+qq+
  SapurV1A.0400s0200.1.p   5 RCAACKYLRRRCPSDCIFSPYFPSNVPQRFACVHRIYGASNVAKMLQQLPAHLRAEAANSLYYEAQSRTQDPVYGCVGVISLLHQQI 91 
                             6************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             ++++++la++++e
  SapurV1A.0400s0200.1.p  92 HSVESQLAKTEAE 104
                             ********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.7364105IPR004883Lateral organ boundaries, LOB
PfamPF031958.5E-415102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MISGRCAACK YLRRRCPSDC IFSPYFPSNV PQRFACVHRI YGASNVAKML QQLPAHLRAE  60
AANSLYYEAQ SRTQDPVYGC VGVISLLHQQ IHSVESQLAK TEAEIAVLNS LAQEPAAQIQ  120
ENEVEATFNN FLLEQDIIAS RRFSHSTYIS SNFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-38610512111LOB family transfactor Ramosa2.1
5ly0_B1e-38610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0400s0200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318256.21e-96LOB domain-containing protein 24
SwissprotP594684e-53LBD24_ARATH; LOB domain-containing protein 24
TrEMBLB9I4F92e-95B9I4F9_POPTR; Uncharacterized protein
STRINGPOPTR_0012s13910.14e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-55LOB domain-containing protein 24